Filter: AllWBIHCAffinity

WB analysis using 80721-1-RR (same clone as 80721-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 80721-1-RR (SYNPO antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 80721-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 80721-1-RR (same clone as 80721-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 80721-1-RR (SYNPO antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80721-1-PBS in a different storage buffer formulation.
IHC staining of mouse kidney using 80721-1-RR (same clone as 80721-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 80721-1-RR (SYNPO antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80721-1-PBS in a different storage buffer formulation.
IHC staining of mouse kidney using 80721-1-RR (same clone as 80721-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 80721-1-RR (SYNPO antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80721-1-PBS in a different storage buffer formulation.
IHC staining of rat kidney using 80721-1-RR (same clone as 80721-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 80721-1-RR (SYNPO antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80721-1-PBS in a different storage buffer formulation.
IHC staining of rat kidney using 80721-1-RR (same clone as 80721-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 80721-1-RR (SYNPO antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80721-1-PBS in a different storage buffer formulation.
IHC staining of mouse kidney using 80721-1-RR (same clone as 80721-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 80721-1-RR (SYNPO antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80721-1-PBS in a different storage buffer formulation.
IHC staining of mouse kidney using 80721-1-RR (same clone as 80721-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 80721-1-RR (SYNPO antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80721-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 80721-1-RR (same clone as 80721-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 80721-1-RR (SYNPO antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80721-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 80721-1-RR (same clone as 80721-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 80721-1-RR (SYNPO antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80721-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 80721-1-RR (same clone as 80721-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 80721-1-RR (SYNPO antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80721-1-PBS in a different storage buffer formulation.
Affinity and Kinetic Characterization of 80721-1-RR
Biolayer interferometry (BLl) kinetic assays of 80721-1-RR against Human SYNPO were performed. The affinity constant is 1.38 nM.

SYNPO Recombinant monoclonal antibody, PBS Only

SYNPO Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 80721-1-PBS

Clone No.4K5

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, Indirect ELISA

Synonyms

Synaptopodin, 4K5, KIAA1029, snaptopodin

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

80721-1-PBS targets SYNPO in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity	human, mouse, rat, pig
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag31287 Product name: Recombinant human SYNPO protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 336-510 aa of BC146665 Sequence: SPPSYSVLYPSSDPKSSHLKGQAVPASKTGILEESMARRGSRKSMFTFVEKPKVTPNPDLLDLVQTADEKRRQRDQGEVGVEEEPFALGAEASNFQQEPAPRDRASPAAAEEVVPEWASCLKSPRIQAKPKPKPNQNLSEASGKGAELYARRQSRMEKYVIESSSHTPELARCPS Predict reactive species
Full Name	synaptopodin
Calculated Molecular Weight	929 aa, 99 kDa
Observed Molecular Weight	100 kDa
GenBank Accession Number	BC146665
Gene Symbol	SYNPO
Gene ID (NCBI)	11346
RRID	AB_2918907
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q8N3V7
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Synaptopodin is a actin-associated protein expressed in mature dendritic spines and renal podocytes. Several isoforms of synaptopodin have been reported: the 100 kDa neural form and 110 kDa renal form. 44-45 kDa may represent the degradation product of synaptopodin. As a podocyte specific protein, synaptopodin expression level was decreased in kidney but increased in the urinary podocytes from patients with preeclampsia, indicating that synaptopodin is a useful marker for preeclampsia. (15841212, 10555072)