• Featured Product
  • KD/KO Validated

Synaptotagmin-1 Polyclonal antibody

Synaptotagmin-1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 14511-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synaptotagmin 1, SYT1, P65, SVP65, synaptotagmin I

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse cerebellum tissue, HCT 116 cells, mouse testis tissue, human liver tissue, Y79 cells
Positive IP detected inmouse cerebellum tissue, HCT 116 cells
Positive IHC detected inrat small intestine tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells, HCT 116 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:4000-1:20000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14511-1-AP targets Synaptotagmin-1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5970

Product name: Recombinant human SYT1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 97-422 aa of BC058917

Sequence: GGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEEEKLGKLQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKFETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEFKVPMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQVVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQVEEEVDAMLAVKK

Predict reactive species
Full Name synaptotagmin I
Calculated Molecular Weight 48 kDa
Observed Molecular Weight 65 kDa, 47 kDa
GenBank Accession NumberBC058917
Gene Symbol Synaptotagmin-1
Gene ID (NCBI) 6857
RRIDAB_2199166
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP21579
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis (PMID: 8058779). SYT1 (synaptotagmin I) was firstly identified as a 65-kDa protein with a wide distribution in neuronal and neurosecretory tissue (PMID: 7298720). Calcium binding to SYT1 participates in triggering neurotransmitter release at the synapse (PMID: 11242035). In addition to regulating exocytosis, SYT1 has also been implicated in endocytosis and neurite outgrowth (PMID: 15492212; 11078930; 10336114). This antibody recognizes endogenous SYT1, which has an experimentally determined molecular mass of 65-68 kDa. An additional band of 47 kDa could also be detected, which is corresponding to the calculated molecular weight of SYT1.

Protocols

Product Specific Protocols
WB protocol for Synaptotagmin-1 antibody 14511-1-APDownload protocol
IHC protocol for Synaptotagmin-1 antibody 14511-1-APDownload protocol
IF protocol for Synaptotagmin-1 antibody 14511-1-APDownload protocol
IP protocol for Synaptotagmin-1 antibody 14511-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell Rep

The complement inhibitor CD59 is required for GABAergic synaptic transmission in the dentate gyrus

Authors - Lang Wen
humanWB

Theranostics

ANKRD22, a novel tumor microenvironment-induced mitochondrial protein promotes metabolic reprogramming of colorectal cancer cells.

Authors - Tianhui Pan

Front Mol Neurosci

A Stimulation Function of Synaptotagmin-1 in Ternary SNARE Complex Formation Dependent on Munc18 and Munc13.

Authors - Yun Li
mouseWB,IHC

J Psychiatr Res

Early life stress enhances the susceptibility to depression and interferes with neuroplasticity in the hippocampus of adolescent mice via regulating miR-34c-5p/SYT1 axis

Authors - Shuwen Yu
mouseWB,IHC

Biochim Biophys Acta Mol Cell Biol Lipids

Hepatic Synaptotagmin 1 is involved in the remodelling of liver plasma- membrane lipid composition and gene expression in male Apoe-deficient mice consuming a Western diet.

Authors - Sara Sancho-Knapik
mouseWB

J Proteomics

Quantitative proteomics reveals olfactory input-dependent alterations in the mouse olfactory bulb proteome.

Authors - Hao-Long Zeng
Loading...
||
New chat Able
正在加载,请稍候...