Synaptotagmin-11 Polyclonal antibody

• 

  WB analysis using 12031-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12031-1-AP (Synaptotagmin-11 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skeletal muscle using 12031-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 12031-1-AP (Synaptotagmin-11 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 12031-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12031-1-AP (Synaptotagmin-11 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 12031-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12031-1-AP (Synaptotagmin-11 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Synaptotagmin-11 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 12031-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

KIAA0080, Synaptotagmin 11, synaptotagmin XI, Synaptotagmin-11, SYT11, SytXI

---

Tested Applications

• Positive WB detected in: rat brain tissue, mouse skeletal muscle tissue, mouse brain tissue
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below

Product Information

12031-1-AP targets Synaptotagmin-11 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2663

  Product name: Recombinant human SYT11 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 159-431 aa of BC013690

  Sequence: GSLTFSVDYNFPKKALVVTIQEAHGLPVMDDQTQGSDPYIKMTILPDKRHRVKTRVLRKTLDPVFDETFTFYGIPYSQLQDLVLHFLVLSFDRFSRDDVIGEVMVPLAGVDPSTGKVQLTRDIIKRNIQKCISRGELQVSLSYQPVAQRMTVVVLKARHLPKMDITGLSGNPYVKVNVYYGRKRIAKKKTHVKKCTLNPIFNESFIYDIPTDLLPDISIEFLVIDFDRTTKNEVVGRLILGAHSVTASGAEHWREVCESPRKPVAKWHSLSEY

• Full Name: synaptotagmin XI
• Calculated Molecular Weight: 431 aa, 48 kDa
• Observed Molecular Weight: 48 kDa，96 kDa
• GenBank Accession Number: BC013690
• Gene Symbol: Synaptotagmin-11
• Gene ID (NCBI): 23208
• RRID: AB_10638432
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BT88
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Biochem Genet; Constructing a Novel Amino Acid Metabolism Signature: A New Perspective on Pheochromocytoma Diagnosis, Immune Landscape, and Immunotherapy; Authors - Zechen Yan