Synaptotagmin-4 Polyclonal antibody

• 

  WB analysis of human brain using 12642-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 12642-1-AP (Synaptotagmin-4 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 12642-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 12642-1-AP (Synaptotagmin-4 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human gliomas using 12642-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas using 12642-1-AP (Synaptotagmin-4 antibody) at dilution of 1:100 (under 10x lens).

Synaptotagmin-4 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 12642-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

SytIV, SYT4, Synaptotagmin IV, KIAA1342

---

Tested Applications

• Positive WB detected in: human brain tissue
• Positive IHC detected in: human gliomas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IHC: See 1 publications below

Product Information

12642-1-AP targets Synaptotagmin-4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3338

  Product name: Recombinant human SYT4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 86-425 aa of BC036538

  Sequence: AVPKNSLHLDLEKRDLNGNFPKTNLKPGSPSDLENATPKLFLEGEKESVSPESLKSSTSLTSEEKQEKLGTLFFSLEYNFERKAFVVNIKEARGLPAMDEQSMTSDPYIKMTILPEKKHKVKTRVLRKTLDPAFDETFTFYGIPYTQIQELALHFTILSFDRFSRDDIIGEVLIPLSGIELSEGKMLMNREIIKRNVRKSSGRGELLISLCYQSTTNTLTVVVLKARHLPKSDVSGLSDPYVKVNLYHAKKRISKKKTHVKKCTPNAVFNELFVFDIPCEGLEDISVEFLVLDSERGSRNEVIGQLVLGAAAEGTGGEHWKEICDYPRRQIAKWHVLCDG

• Full Name: synaptotagmin IV
• Calculated Molecular Weight: 425 aa, 48 kDa
• Observed Molecular Weight: 45-48 kDa
• GenBank Accession Number: BC036538
• Gene Symbol: Synaptotagmin-4
• Gene ID (NCBI): 6860
• RRID: AB_2302982
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H2B2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Histochem Cell Biol; Significance of achaete-scute complex homologue 1 (ASCL1) in pulmonary neuroendocrine carcinomas; RNA sequence analyses using small cell lung cancer cells and Ascl1-induced pulmonary neuroendocrine carcinoma cells.; Authors - Shinji Kudoh
human	WB	J Biol Chem; Lactate promotes neuronal differentiation of SH-SY5Y cells by lactate-responsive gene sets through NDRG3-dependent and -independent manners; Authors - Yidan Xu