Synaptotagmin-4 Polyclonal antibody

• 

  WB analysis of SH-SY5Y using 20472-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 20472-1-AP (Synaptotagmin-4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 20472-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 20472-1-AP (Synaptotagmin-4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 20472-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 20472-1-AP (Synaptotagmin-4 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

Synaptotagmin-4 Polyclonal Antibody for WB, ELISA

Cat No. 20472-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

KIAA1342, Synaptotagmin IV, SYT4, SytIV

---

Tested Applications

• Positive WB detected in: SH-SY5Y cells, A431 cells, mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20472-1-AP targets Synaptotagmin-4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14318

  Product name: Recombinant human SYT4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-187 aa of BC036538

  Sequence: MAPITTSREEFDEIPTVVGIFSAFGLVFTVSLFAWICCQRKSSKSNKTPPYKFVHVLKGVDIYPENLNSKKKFGADDKNEVKNKPAVPKNSLHLDLEKRDLNGNFPKTNLKPGSPSDLENATPKLFLEGEKESVSPESLKSSTSLTSEEKQEKLGTLFFSLEYNFERKAFVVNIKEARGLPAMDEQS

• Full Name: synaptotagmin IV
• Calculated Molecular Weight: 425 aa, 48 kDa
• Observed Molecular Weight: 48-50 kDa
• GenBank Accession Number: BC036538
• Gene Symbol: Synaptotagmin-4
• Gene ID (NCBI): 6860
• RRID: AB_10695633
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H2B2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis (PMID: 8058779). Synaptotagmin-4 is an atypical synaptic vesicle protein that is expressed in the dendrites of neurons. It mediates retrograde signals at the synapse and the release of BDNF, and regulates synaptic plasticity, motor learning, and memory.