SYTL1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SYTL1 Polyclonal antibody, PBS Only (31834-1-PBS)

• 

  WB analysis using 31834-1-AP (same clone as 31834-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31834-1-AP (SYTL1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31834-1-PBS in a different storage buffer formulation.

SYTL1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31834-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Exophilin-7, Protein JFC1, SLP1, Synaptotagmin-like protein 1

---

Product Information

31834-1-PBS targets SYTL1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27391

  Product name: Recombinant human SYTL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 106-326 aa of BC015764

  Sequence: MRRKKSTRGDQAPGHDREAEAAVKEKEEGPEPRLTIDEAPQERLRETEGPDFPSPSVPLKASDPEEASQAQEDPGQGDQQVCAEEADPELEPASGGEQEPRPQQAQTKAASQILENGEEAPGPDPSLDRMLSSSSSVSSLNSSTLSGSQMSLSGDAEAVQVRGSVHFALHYEPGAAELRVHVIQCQGLAAARRRRSDPYVKSYLLPDKQSKRKTAVKKRNL

• Full Name: synaptotagmin-like 1
• Calculated Molecular Weight: 62 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC015764
• Gene Symbol: SYTL1
• Gene ID (NCBI): 84958
• RRID: AB_3742482
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8IYJ3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Synaptotagmin-like protein 1 (SYTL1, also known as SLP1 and Exophilin-7) is a protein that plays a crucial role in vesicle trafficking and exocytosis. SYTL1 differentially regulates the secretion of prostate-specific antigen and prostatic-specific acid phosphatase (PMID: 36653850). The expression level of SYTL1 is also associated with bladder cancer progression (PMID: 36107384).