SYTL3 Polyclonal antibody

• 

  WB analysis of mouse liver using 22076-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 22076-1-AP (SYTL3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human kidney using 22076-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 22076-1-AP (SYTL3 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human kidney using 22076-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 22076-1-AP (SYTL3 Antibody) at dilution of 1:200 (under 40x lens).

SYTL3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 22076-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Exophilin 6, SLP3, synaptotagmin like 3, Synaptotagmin like protein 3, SYTL3

---

Tested Applications

• Positive WB detected in: mouse liver tissue
• Positive IHC detected in: human kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

22076-1-AP targets SYTL3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17219

  Product name: Recombinant human SYTL3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 302-610 aa of BC100830

  Sequence: DNANVTGEIEFAIHYCFKTHSLEICIKACKNLAYGEEKKKKCNPYVKTYLLPDRSSQGKRKTGVQRNTVDPTFQETLKYQVAPAQLVTRQLQVSVWHLGTLARRVFLGEVIIPLATWDFEDSTTQSFRWHPLRAKAEKYEDSVPQSNGELTVRAKLVLPSRPRKLQEAQEGTDQPSLHGQLCLVVLGAKNLPVRPDGTLNSFVKGCLTLPDQQKLRLKSPVLRKQACPQWKHSFVFSGVTPAQLRQSSLELTVWDQALFGMNDRLLGGTRLGSKGDTAVGGDACSQSKLQWQKVLSSPNLWTDMTLVLH

• Full Name: synaptotagmin-like 3
• Calculated Molecular Weight: 610 aa, 69 kDa
• Observed Molecular Weight: 69 kDa
• GenBank Accession Number: BC100830
• Gene Symbol: SYTL3
• Gene ID (NCBI): 94120
• RRID: AB_2878984
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q4VX76
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Commun; IP6-assisted CSN-COP1 competition regulates a CRL4-ETV5 proteolytic checkpoint to safeguard glucose-induced insulin secretion.; Authors - Hong Lin
human,rat	WB	PLoS One; Mast cell granule motility and exocytosis is driven by dynamic microtubule formation and kinesin-1 motor function.; Authors - Jeremies Ibanga