SYTL4 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83564-5-RR (same clone as 83564-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83564-5-RR (SYTL4 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83564-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83564-5-RR

  Biolayer interferometry (BLl) kinetic assays of 83564-5-RR against Human SYTL4 were performed. The affinity constant is below 1 pM.

SYTL4 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 83564-5-PBS

Clone No.240556E2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

synaptotagmin like 4, SLP4, Granuphilin, Exophilin-2, Exophilin 2

---

Product Information

83564-5-PBS targets SYTL4 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2772

  Product name: Recombinant human SYTL4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 338-671 aa of BC014913

  Sequence: IGSMMSIYSEAGDFGNIFVTGRIAFSLKYEQQTQSLVVHVKECHQLAYADEAKKRSNPYVKTYLLPDKSRQGKRKTSIKRDTVNPLYDETLRYEIPESLLAQRTLQFSVWHHGRFGRNTFLGEAEIQMDSWKLDKKLDHCLPLHGKISAESPTGLPSHKGELVVSLKYIPASKTPVGGDRKKSKGGEGGELQVWIKEAKNLTAAKAGGTSDSFVKGYLLPMRNKASKRKTPVMKKTLNPHYNHTFVYNGVRLEDLQHMCLELTVWDREPLASNDFLGGVRLGVGTGISNGEVVDWMDSTGEEVSLWQKMRQYPGSWAEGTLQLRSSMAKQKLGL

• Full Name: synaptotagmin-like 4
• Calculated Molecular Weight: 671 aa, 76 kDa
• Observed Molecular Weight: 74-76 kDa
• GenBank Accession Number: BC014913
• Gene Symbol: SYTL4
• Gene ID (NCBI): 94121
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q96C24
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SYTL4, also known as SLP4 or granuphilin, is a member of the synaptotagmin-like protein (Slp) family. Members of this family are characterized by presence of an N-terminal Slp homology domain (SHD), which functions as a Rab27-binding domain, and C-terminal tandem C2 domains, putative Ca(2+)-binding motifs. SYTL4 is specifically expressed on dense-core granules in certain neuroendocrine cells and negatively controls dense-core vesicle exocytosis through specific interaction with Rab27A. (PMID: 16481396; 16473610)