SZRD1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• SZRD1 Polyclonal antibody, PBS Only (24844-1-PBS)

• 

  WB analysis using 24844-1-AP (same clone as 24844-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24844-1-AP (SZRD1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24844-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 24844-1-AP (same clone as 24844-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 24844-1-AP (SZRD1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24844-1-PBS in a different storage buffer formulation.

SZRD1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 24844-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

C1orf144, UPF0485 protein C1orf144, SUZ RNA-binding domain-containing, SUZ domain-containing protein 1, Putative MAPK-activating protein PM18/PM20/PM22

---

Product Information

24844-1-PBS targets SZRD1 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20507

  Product name: Recombinant human SZRD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-133 aa of BC023988

  Sequence: MRRSLRAGKRRQTAGRKSKSPPKVPIVIQDDSLPAGPPPQIRILKRPTSNGVVSSPNSTSRPTLPVKSLAQREAEYAEARKRILGSASPEEEQEKPILDRPTRISQPEDSRQPNNVIRQPLGPDGSQGFKQRR

• Full Name: chromosome 1 open reading frame 144
• Calculated Molecular Weight: 152 aa, 17 kDa
• Observed Molecular Weight: 18-22 kDa
• GenBank Accession Number: BC023988
• Gene Symbol: SZRD1/C1orf144
• Gene ID (NCBI): 26099
• RRID: AB_3085759
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7Z422
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.