SZT2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SZT2 Polyclonal antibody (33062-1-AP)

• 

  WB analysis using 33062-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33062-1-AP (C1orf84 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HL-60 using 33062-1-AP

  IP result of anti-C1orf84 (IP:33062-1-AP, 4ug; Detection:33062-1-AP 1:600) with HL-60 cells lysate 1480 ug.

SZT2 Polyclonal Antibody for WB, ELISA

Cat No. 33062-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

C1orf84, KIAA0467, KICSTOR complex protein SZT2, Seizure threshold 2 protein homolog, SZT2 Subunit Of KICSTOR Complex

---

Tested Applications

• Positive WB detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33062-1-AP targets SZT2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36664

  Product name: Recombinant human C1orf84 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2390-2520 aa of NM_015284

  Sequence: QLLPASLCTEDTPTGSLRNGSLETKSSAGRASTFPPAPVPGEPVTPPSKAGRRSFWDMLSKTECGDLGSPKTTDDIVLDRPEDTRGRRRHKTESVRTPGGAERAPGSDSGAQRQKRRTTQLEEGEVGTLHP

• Full Name: KIAA0467
• Observed Molecular Weight: 300 kDa
• GenBank Accession Number: NM_015284
• Gene Symbol: C1orf84
• Gene ID (NCBI): 23334
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q5T011
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SZT2 (Seizure Threshold 2) is a large transmembrane protein rich in leucine-rich repeats (LRRs) and primarily localized to the lysosomal membrane. Its core molecular function is to serve as a central scaffold protein of the KICSTOR complex. Under amino acid starvation conditions, it anchors the negative regulator GATOR1 to the lysosomal surface through its scaffolding role, thereby inhibiting excessive activation of the mTORC1 signaling pathway and maintaining cellular growth and metabolic balance. Mutations in the SZT2 gene cause neurodevelopmental disorders such as early-onset epileptic encephalopathy, developmental delay, intellectual disability, and macrocephaly, highlighting its critical role in regulating neuronal excitability. Furthermore, SZT2 is involved in autophagy regulation and the maintenance of lysosomal function; its deficiency leads to impaired clearance of materials within neurons. In neuroscience research, anti-SZT2 antibodies are widely used for exploring epilepsy mechanisms, studying the mTOR signaling pathway, and analyzing neurodevelopmental disease models.