Sa Cas9 Polyclonal antibody

• 

  WB analysis of Recombinant protein using 26927-1-AP

  Recombinant protein were subjected to SDS PAGE followed by western blot with 26927-1-AP (Sa Cas9 Antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

Sa Cas9 Polyclonal Antibody for WB, ELISA

Cat No. 26927-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Staphylococcus aureus

Applications

WB, ELISA

Synonyms

Cas9, Sa Cas9, SaCas9

---

Tested Applications

• Positive WB detected in: Recombinant protein

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26927-1-AP targets Sa Cas9 in WB, ELISA applications and shows reactivity with Staphylococcus aureus samples.

• Tested Reactivity: Staphylococcus aureus
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25669

  Product name: Recombinant Sa Cas9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-100 aa of

  Sequence: MKRNYILGLDIGITSVGYGIIDYETRDVIDAGVRLFKEANVENNEGRRSKRGARRLKRRRRHRIQRVKKLLFDYNLLTDHSELSGINPYEARVKGLSQKL

• Full Name: Sa Cas9
• RRID: AB_2880688
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cas9 (CRISPR associated protein 9) is an RNA-guided DNA endonuclease enzyme associated with the CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) adaptive immunity system in Streptococcus pyogenes (Sp). This antibody detects the Cas9 of Staphylococcus aureus (SaCas9). It can't detect the SpCas9.