Sam68 Recombinant monoclonal antibody, PBS Only (Capture/Detector)

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Sam68 Recombinant monoclonal antibody, PBS Only (Capture/Detector) (88301-1-PBS)

Sam68 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 88301-1-PBS

Clone No.260478D3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Cytometric bead array, Sandwich ELISA, Indirect ELISA

Synonyms

KHDRBS1, GAP-associated tyrosine phosphoprotein p62, KH domain-containing, RNA-binding, signal transduction-associated protein 1, KHDRBS 1, p21 Ras GTPase-activating protein-associated p62

• 

  WB analysis using 88301-1-RR (same clone as 88301-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 88301-1-RR (Sam68 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 88301-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Sandwich ELISA sample test of MP03453-2

  The mean Sam68 concentration was determined to be 17.46 ng/mL in A2780 cell extract based on a 1.2 mg/mL extract load, 6.52 ng/mL in Caco-2 cell extract based on a 1.2 mg/mL extract load and 683.88 ng/mL in HEK-293 cell extract based on a 1.2 mg/mL extract load.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Sandwich ELISA standard curve of MP03453-2

  Sandwich ELISA standard curve of MP03453-2, Human Sam68 Recombinant Matched Antibody Pair - PBS only. 88301-1-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag0235. 88301-3-PBS was HRP conjugated as the detection antibody. Range: 0.195-12.5 ng/mL

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 88301-1-RR (same clone as 88301-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using Sam68 antibody (88301-1-RR, Clone: 260478D3 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 88301-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Cytometric bead array sample test of MP03453-1

  The mean Sam68 concentration was determined to be 1791.9 ng/mL in HEK-293 cell extract based on a 1.0 mg/mL extract load, 7.8 ng/mL in Caco-2 cell extract based on a 1.0 mg/mL extract load.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  Cytometric bead array standard curve of MP03453-1

  Cytometric bead array standard curve of MP03453-1, Sam68 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 88301-2-PBS. Detection antibody: 88301-1-PBS. Standard: Ag0235. Range: 0.625-80 ng/mL.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

88301-1-PBS targets Sam68 as part of a matched antibody pair:

MP03453-1: 88301-2-PBS capture and 88301-1-PBS detection (validated in Cytometric bead array)

MP03453-2: 88301-1-PBS capture and 88301-3-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0235

  Product name: Recombinant human Sam68 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 201-442 aa of BC000717

  Sequence: GSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLNGVPEPSRGRGVPVRGRGAAPPPPPVPRGRGVGPPRGALVRGTPVRGAITRGATVTRGVPPPPTVRGAPAPRARTAGIQRIPLPPPPAPETYEEYGYDDTYAEQSYEGYEGYYSQSQGDSEYYDYGHGEVQDSYEAYGQDDWNGTRPSLKAPPARPVKGAYREHPYGR

• Full Name: KH domain containing, RNA binding, signal transduction associated 1
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 68 kDa
• GenBank Accession Number: BC000717
• Gene Symbol: Sam68
• Gene ID (NCBI): 10657
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q07666
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

KHDRBS1, also named as SAM68, p62and p68, belongs to the KHDRBS family. It is recruited and tyrosine phosphorylated by several receptor systems, for example the T-cell, leptin and INS receptors. Once phosphorylated, KHDRBS1 functions as an adapter protein in signal transduction cascades by binding to SH2 and SH3 domain-containing proteins. It represses CBP-dependent transcriptional activation apparently by competing with other nuclear factors for binding to CBP.