Sarcalumenin Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Sarcalumenin Polyclonal antibody (33909-1-AP)

• 

  WB analysis using 33909-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33909-1-AP (Sarcalumenin antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse heart using 33909-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 33909-1-AP (Sarcalumenin antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skeletal muscle using 33909-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 33909-1-AP (Sarcalumenin antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

Sarcalumenin Polyclonal Antibody for WB, IHC, ELISA

Cat No. 33909-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

SAR, SRL

---

Tested Applications

• Positive WB detected in: mouse heart tissue, mouse skeletal muscle tissue, rat heart tissue, rat skeletal muscle tissue
• Positive IHC detected in: mouse skeletal muscle tissue, mouse heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33909-1-AP targets Sarcalumenin in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag40750

  Product name: Recombinant human SRL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 399-473 aa of BC160181

  Sequence: EAYKDFFGINPISSFKLLSQQCSYMGGCFLEKIERAITQELPGLLGSLGLGKNPGALNCDKTGCSETPKNRYRKH

• Full Name: sarcalumenin
• Observed Molecular Weight: 53 kDa
• GenBank Accession Number: BC160181
• Gene Symbol: SRL
• Gene ID (NCBI): 6345
• RRID: AB_3743108
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q86TD4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Sarcalumenin, also known as SAR, is a luminal Ca2+ buffer protein with high capacity but low affinity for calcium binding found predominantly in the longitudinal sarcoplasmic reticulum (SR) of fast and slow-twitch skeletal muscles and the heart. Together with other luminal Ca2+ buffer proteins, SAR plays a critical role in modulation of Ca2+ uptake and Ca2+ release during excitation-contraction coupling in muscle fibers. SAR appears to be important in a wide range of other physiological functions, such as stabilizing Sarco-Endoplasmic Reticulum Calcium ATPase (SERCA), regulating Store-Operated Calcium Entry (SOCE) mechanisms, enhancing muscle fatigue resistance, and promoting muscle development. The SAR has a molecular weight of 160 kDa (long isoform). Due to alternative splicing, the SAR gene also encodes a 53 kDa glycoprotein variant (short isoform), which shares the identical COOH-terminal half with SAR and lacks Ca²⁺-binding capacity (PMID: 19502553, PMID: 36899851).