Septin 8 Monoclonal antibody, PBS Only

• 

  WB analysis of HeLa using 66188-1-Ig (same clone as 66188-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 66188-1-Ig (Septin 8 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66188-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 66188-1-Ig (same clone as 66188-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66188-1-Ig (Septin 8 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66188-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 66188-1-Ig (same clone as 66188-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66188-1-Ig (Septin 8 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66188-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 66188-1-Ig (same clone as 66188-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 66188-1-Ig (Septin 8 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66188-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 66188-1-Ig (same clone as 66188-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 66188-1-Ig (Septin 8 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66188-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 66188-1-Ig (same clone as 66188-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using Septin 8 antibody (66188-1-Ig, Clone: 4A12G9 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66188-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 66188-1-Ig (same clone as 66188-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using Septin 8 antibody (66188-1-Ig, Clone: 4A12G9 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66188-1-PBS in a different storage buffer formulation.

Septin 8 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66188-1-PBS

Clone No.4A12G9

Host / Isotype

Mouse / IgM

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

SEPT8, KIAA0202, SEP2, SEPTIN8, Septin-8

---

Mouse monoclonal antibodies of IgM isotype can be detected with "anti-mouse IgG (H+L)" secondary antibodies.

Product Information

66188-1-PBS targets Septin 8 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgM
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19114

  Product name: Recombinant human SEPT8 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-256 aa of BC001329

  Sequence: MKKLDSKVNIIPIIAKADTISKSELHKFKIKIMGELVSNGVQIYQFPTDDEAVAEINAVMNAHLPFAVVGSTEEVKVGNKLVRARQYPWGVVQVENENHCDFVKLREMLIRVNMEDLREQTHSRHYELYRRCKLEEMGFQDSDGDSQPFSLQETYEAKRKEFLSELQRKEEEMRQMFVNKVKETELELKEKERELHEKFEHLKRVHQEEKRKVEEKRRELEEETNAFNRRKAAVEALQSQALHATSQQPLRKDKDK

• Full Name: septin 8
• Calculated Molecular Weight: 55.6 kDa
• Observed Molecular Weight: 50-58 kDa
• GenBank Accession Number: BC001329
• Gene Symbol: Septin 8
• Gene ID (NCBI): 23176
• RRID: AB_2881583
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Thiophilic affinity chromatograph
• UNIPROT ID: Q92599
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Septin 8, also named as KIAA0202, is a member of the highly conserved septin family. Septins are membrane-associated GTPases which are involved in cytokinesis and cellular morphogenesis. Septin 8 is an interaction partner of Septin 4. It may play a role in platelet secretion.