• Featured Product
  • KD/KO Validated

Sestrin 2 Recombinant monoclonal antibody, PBS Only (Detector)

Sestrin 2 Uni-rAb® Recombinant Antibody for WB, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 83202-3-PBS
Clone No.240034H3

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), Cytometric bead array, Indirect ELISA

SESN2, Sestrin2, 240034H3, EC:1.11.1.-, Hi95

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83202-3-PBS targets Sestrin 2 as part of a matched antibody pair:

MP00278-1: 83202-2-PBS capture and 83202-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1247

Product name: Recombinant human Sestrin2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 132-480 aa of BC013304

Sequence: HMAEFLQTGGDPEWLLGLHRAPEKLRKLSEINKLLAHRPWLITKEHIQALLKTGEHTWSLAELIQALVLLTHCHSLSSFVFGCGILPEGDADGSPAPQAPTPPSEQSSPPSRDPLNNSGGFESARDVEALMERMQQLQESLLRDEGTSQEEMESRFELEKSESLLVTPSADILEPSPHPDMLCFVEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYSLIQRLYPEGGQLLDEKFQAAYSLTYNTIAMHSGVDTSVLRRAIWNYIHCVFGIRYDDYDYGEVNQLLERNLKVYIKTVACYPEKTTRRMYNLFWRHFRHSEKVHVNLLLLEARMQAALLYALRAITRYMT

Predict reactive species
Full Name sestrin 2
Calculated Molecular Weight 54 kDa
Observed Molecular Weight54 kDa
GenBank Accession NumberBC013304
Gene Symbol SESN2/Sestrin 2
Gene ID (NCBI) 83667
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP58004
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

SESN is a family of highly conserved, stress-inducible genes that can defend the cell against oxidative damage and oncogenic signaling. SESN2 ,which belongs to the SESN family, has been implicated as a tumor suppressor that can inhibit angiogenesis and promote autophagy, underscoring the importance of elucidating the molecular mechanism by which SESN2 regulates pathways of metabolism and survival.(PMID:22363791).

Loading...
||
New chat Able
正在加载,请稍候...