Mouse CD169 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 86605-1-RR (same clone as 86605-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86605-1-RR (Siglec1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86605-1-PBS in a different storage buffer formulation.

• 

  Sandwich ELISA sample test of MP02539-1

  The mean Sialoadhesin/CD169 concentration was determined to be 519.6 ng/mL in mouse spleen tissue extract based on a 8.5 mg/mL extract load.

• 

  Sandwich ELISA standard curve of MP02539-1

  Sandwich ELISA standard curve of MP02539-1, Mouse Sialoadhesin/CD169 Recombinant Matched Antibody Pair - PBS only. 86605-1-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Eg5002. 86605-2-PBS was HRP conjugated as the detection antibody. Range: 78.1-5000 pg/mL.

• 

  Cytometric bead array sample test of MP02539-1

  The mean Sialoadhesin/CD169 concentration was determined to be 351.7 ng/mL in Mouse spleen tissue extract based on a 6.4 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP02539-1

  Cytometric bead array standard curve of MP02539-1, MOUSE Sialoadhesin/CD169 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 86605-1-PBS. Detection antibody: 86605-2-PBS. Standard: Eg5002. Range: 0.625-40 ng/mL.

CD169 Uni-rAb^® Recombinant Antibody for WB, Cytometric bead array, Sandwich ELISA, Indirect ELISA

Cat No. 86605-1-PBS

Clone No.251348G9

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, Cytometric bead array, Sandwich ELISA, Indirect ELISA

Synonyms

Sa, SER, Sheep erythrocyte receptor, Sialic acid-binding Ig-like lectin 1, Sialoadhesin

---

Product Information

86605-1-PBS targets CD169 as part of a matched antibody pair:

MP02539-1: 86605-1-PBS capture and 86605-2-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg5002

  Product name: recombinant mouse Siglec1 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 20-510 aa of NP_035556

  Sequence: TWGVSSPKNVQGLSGSCLLIPCIFSYPADVPVSNGITAIWYYDYSGKRQVVIHSGDPKLVDKRFRGRAELMGNMDHKVCNLLLKDLKPEDSGTYNFRFEISDSNRWLDVKGTTVTVTTDPSPPTITIPEELREGMERNFNCSTPYLCLQEKQVSLQWRGQDPTHSVTSSFQSLEPTGVYHQTTLHMALSWQDHGRTLLCQFSLGAHSSRKEVYLQVPHAPKGVEILLSSSGRNILPGDPVTLTCRVNSSYPAVSAVQWARDGVNLGVTGHVLRLFSAAWNDSGAYTCQATNDMGSLVSSPLSLHVFMAEVKMNPAGPVLENETVTLLCSTPKEAPQELRYSWYKNHILLEDAHASTLHLPAVTRADTGFYFCEVQNAQGSERSSPLSVVVRYPPLTPDLTTFLETQAGLVGILHCSVVSEPLATVVLSHGGLTLASNSGENDFNPRFRISSAPNSLRLEIRDLQPADSGEYTCLAVNSLGNSTSSLDFYAN

• Full Name: sialic acid binding Ig-like lectin 1, sialoadhesin
• Calculated Molecular Weight: 183 kDa
• Observed Molecular Weight: 220 kDa
• GenBank Accession Number: NP_035556
• Gene Symbol: Siglec1
• Gene ID (NCBI): 20612
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q62230-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD169, also known as sheep erythrocyte receptor (SER), Sialoadhesin (Sn) or Siglec-1, is a sialic acid-binding immunoglobulin-like lectin that belongs to the SIGLEC family of the Ig superfamily (PMID: 3783087; 11133773). CD169 is a single-pass transmembrane protein containing a long extracellular domain, a transmembrane region, and a short cytoplasmic tail (PMID: 11133773). It is primarily expressed on the surface of specific macrophage subsets and its precursor monocytes, as well as on some DCs (PMID: 33408860). CD169 binds to sialic acid-containing glycoconjugates, particularly those with α(2,3)-linkages. It is involved in immune regulation, pathogen recognition, and cell-cell interactions.