Home
Products
Primary Antibodies
Sortilin Monoclonal antibody, PBS Only (68007-1-PBS)

Sortilin Monoclonal antibody, PBS Only

Name: Sortilin Monoclonal antibody, PBS Only, 100ug
Brand: Proteintech
SKU: 68007-1-PBS-100UG

Sortilin Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 68007-1-PBS

Clone No. 2B11B9

Review Product

Download datasheet

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, IF-P, ELISA

Synonyms

SORT1, 100 kDa NT receptor, Glycoprotein 95, Gp95, Neurotensin receptor 3

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCIF-PIF/ICC

WB analysis using 68007-1-Ig (same clone as 68007-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 68007-1-Ig (Sortilin antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68007-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of SKOV-3 using 68007-1-Ig (same clone as 68007-1-PBS)
WB result of Sortilin antibody (68007-1-Ig; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Sortilin transfected SKOV-3 cells. This data was developed using the same antibody clone with 68007-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 68007-1-Ig (same clone as 68007-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 68007-1-Ig (Sortilin antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68007-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse brain using 68007-1-Ig (same clone as 68007-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 68007-1-Ig (Sortilin antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68007-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse brain using 68007-1-Ig (same clone as 68007-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 68007-1-Ig (Sortilin antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68007-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse brain using 68007-1-Ig (same clone as 68007-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 68007-1-Ig (Sortilin antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68007-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse brain using 68007-1-Ig (same clone as 68007-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 68007-1-Ig (Sortilin antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68007-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lung cancer using 68007-1-Ig (same clone as 68007-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 68007-1-Ig (Sortilin antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68007-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human lung cancer using 68007-1-Ig (same clone as 68007-1-PBS)
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 68007-1-Ig (Sortilin antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68007-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of mouse brain using 68007-1-Ig (same clone as 68007-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using Sortilin antibody (68007-1-Ig, Clone: 2B11B9 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68007-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HeLa using 68007-1-Ig (same clone as 68007-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed HeLa cells using Sortilin antibody (68007-1-Ig, Clone: 2B11B9 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-Phalloidin (red). This data was developed using the same antibody clone with 68007-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of SH-SY5Y using 68007-1-Ig (same clone as 68007-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed SH-SY5Y cells using Sortilin antibody (68007-1-Ig, Clone: 2B11B9 ) at dilution of 1:800 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Mouse Recombinant Secondary Antibody (H+L) (RGAM002). This data was developed using the same antibody clone with 68007-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of SH-SY5Y using 68007-1-Ig (same clone as 68007-1-PBS)
Immunofluorescent analysis of (-20°C Ethanol) fixed SH-SY5Y cells using Sortilin antibody (68007-1-Ig, Clone: 2B11B9 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68007-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Sortilin in ?

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

68007-1-PBS targets Sortilin in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity	human, mouse, rat, pig
Host / Isotype	Mouse / IgG2a
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag28043 Product name: Recombinant human SORT1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 481-831 aa of BC023542 Sequence: EPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCWQTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSNSVPIILAIVGLMLVTVVAGVLIVKKYVCGGRFLVHRYSVLQQHAEANGVDGVDALDTASHTNKSGYHDDSDEDLLE Predict reactive species
Full Name	sortilin 1
Calculated Molecular Weight	831 aa, 92 kDa
Observed Molecular Weight	95-100 kDa
GenBank Accession Number	BC023542
Gene Symbol	Sortilin
Gene ID (NCBI)	6272
ENSEMBL Gene ID	ENSG00000134243
RRID	AB_2918754
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q99523
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Sortilin 1 (SORT1), is a trans-Golgi network (TGN) transmembrane protein and is a member of the Vps10p domain receptor family. SORT1 binds a number of unrelated ligands that participate in a wide range of cellular processes. It functions as a sorting receptor in the Golgi compartment and as a clearance receptor on the cell surface.