Spexin Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Spexin Polyclonal antibody, PBS Only (20467-1-PBS)

• 

  IHC staining of mouse heart using 20467-1-AP (same clone as 20467-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 20467-1-AP (C12orf39 antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20467-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse heart using 20467-1-AP (same clone as 20467-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 20467-1-AP (C12orf39 antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20467-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 20467-1-AP (same clone as 20467-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 20467-1-AP (Spexin antibody) at dilution of 1:100 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20467-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 20467-1-AP (same clone as 20467-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 20467-1-AP (Spexin antibody) at dilution of 1:100 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20467-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse heart using 20467-1-AP (same clone as 20467-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse heart tissue using C12orf39 antibody (20467-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20467-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse liver using 20467-1-AP (same clone as 20467-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse liver tissue using Spexin antibody (20467-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 20467-1-PBS in a different storage buffer formulation.

Spexin Polyclonal Antibody for IHC, IF-P, Indirect ELISA

Cat No. 20467-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF-P, Indirect ELISA

Synonyms

C12orf39, Neuropeptide Q, Spexin hormone, Spexin-1, Spexin-2

---

Product Information

20467-1-PBS targets Spexin in IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14304

  Product name: Recombinant human C12orf39 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-116 aa of BC004336

  Sequence: MKGLRSLAATTLALFLVFVFLGNSSCAPQRLLERRNWTPQAMLYLKGAQGRRFISDQSRRKDLSDRPLPERRSPNPQLLTIPEAATILLASLQKSPEDEEKNFDQTRFLEDSLLNW

• Full Name: chromosome 12 open reading frame 39
• Calculated Molecular Weight: 116 aa, 13 kDa
• GenBank Accession Number: BC004336
• Gene Symbol: C12orf39
• Gene ID (NCBI): 80763
• RRID: AB_3741996
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BT56
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Spexin (SPX), also known as neuropeptide Q, is a novel and highly conserved neuroendocrine peptide discovered through bioinformatics. Spexin and its receptors (primarily galanin receptor types 2 and 3) are widely expressed throughout the body, including the central nervous system, gastrointestinal tract, adipose tissue, kidneys, and cardiovascular system. Research indicates that Spexin is a multifunctional regulatory peptide, with its most central role being in energy homeostasis and metabolic regulation. It functions to suppress appetite, reduce body weight, and improve insulin resistance and glucose metabolism, making it a potential biomarker and therapeutic target for metabolic diseases such as obesity and type 2 diabetes. Additionally, Spexin is involved in regulating various physiological and pathological processes, including pain perception, anxiety- and depression-like behaviors, cardiovascular function, and reproductive activities.