• Featured Product
  • KD/KO Validated

Stathmin 1 Recombinant monoclonal antibody

Stathmin 1 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, IF-P, ELISA
Cat No. 82559-1-RR
Clone No.2H6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, ELISA

STMN1, 2H6, C1orf215, LAP18, Leukemia-associated phosphoprotein p18

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inSH-SY5Y cells, HepG2 cells, Jurkat cells, PC-12 cells
Positive IHC detected inrat brain tissue, human tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue
Positive IF/ICC detected inHeLa cells, NIH/3T3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)-PIF-P : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

82559-1-RR targets Stathmin 1 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1633

Product name: Recombinant human STMN1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-149 aa of BC014353

Sequence: MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDFSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD

Predict reactive species
Full Name stathmin 1/oncoprotein 18
Calculated Molecular Weight 18 kDa
Observed Molecular Weight 18 kDa
GenBank Accession NumberBC014353
Gene Symbol Stathmin 1
Gene ID (NCBI) 3925
RRIDAB_3086489
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP16949
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Stathmin 1 (STMN1) normally regulates microtubule dynamics either by sequestering free tubulin heterodimers or by promoting microtubule catastrophe. STMN1 is highly expressed in fetal and adult brain, spinal cord, and cerebellum. Many different phosphorylated forms are observed depending on specific combinations among the sites which can be phosphorylated. Phosphorylation of stathmin is involved in response to NGF, neuron polarization and microtubule polymerization inhibition activity. Increased expression of STMN1 has been observed in a variety of human malignancies, such as colorectal primary tumors and metastatic tissues, but its association with melanoma is so far not well known.

Protocols

Product Specific Protocols
WB protocol for Stathmin 1 antibody 82559-1-RRDownload protocol
IHC protocol for Stathmin 1 antibody 82559-1-RRDownload protocol
IF protocol for Stathmin 1 antibody 82559-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Frédéric (Verified Customer) (11-22-2024)

Good detection of stathmin-1 protein at expected molecular weight.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: A431cells - P12 cells - rat pituitary cells
Stathmin 1 Antibody Western Blot validation (1/1000 dilution) in A431cells - P12 cells - rat pituitary cells (Cat no:82559-1-RR)
Loading...
||
New chat Able
正在加载,请稍候...