SYNGR1 Polyclonal antibody

• 

  WB analysis using 29734-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29734-1-AP (SYNGR1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 29734-1-AP

  Unboiled rat brain tissue was subjected to SDS PAGE followed by western blot with 29734-1-AP (SYNGR1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 29734-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 29734-1-AP (SYNGR1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 29734-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 29734-1-AP (SYNGR1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 29734-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 29734-1-AP (SYNGR1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat brain using 29734-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 29734-1-AP (SYNGR1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

SYNGR1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 29734-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Synaptogyrin-1, synaptogyrin 1

---

Tested Applications

• Positive WB detected in: unboiled rat brain tissue, mouse brain tissue, rat brain tissue
• Positive IHC detected in: mouse brain tissue, rat brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

29734-1-AP targets SYNGR1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag31214

  Product name: Recombinant human SYNGR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-92 aa of BC000731

  Sequence: MEGGAYGAGKAGGAFDPYTLVRQPHTILRVVSWLFSIVVFGSIVNEGYLNSASEGEEFCIYNRNPNACSYGVAVGVLAFLTCLLYLALDVYF

• Full Name: synaptogyrin 1
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 28-30 kDa
• GenBank Accession Number: BC000731
• Gene Symbol: SYNGR1
• Gene ID (NCBI): 9145
• RRID: AB_2923601
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43759
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Synaptogyrins are one of the most abundant vesicle components and are involved in the regulation of neurotransmitter release and synaptic plasticity. Synaptogyrins comprise a family of tyrosine-phosphorylated proteins with three isoforms: two neuronal forms (synaptogyrin-1 and -3) and one ubiquitous form (synaptogyrin-2). The synaptogyrin 1 (SYNGR1) can act as a regulator of Ca2+-dependent exocytosis. SYNGR1 protein mutations are associated with schizophrenia and are considered to be positional candidate genes for schizophrenia.(PMID: 10383386; 10595519; 14755516; 14732601; 17049558)