Synaptotagmin-3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Synaptotagmin-3 Polyclonal antibody, PBS Only (28667-1-PBS)

• 

  WB analysis using 28667-1-AP (same clone as 28667-1-PBS)

  mouse brain tissue and rat brain tissue were subjected to SDS PAGE followed by western blot with 28667-1-AP (Synaptotagmin-3 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28667-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 28667-1-AP (same clone as 28667-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28667-1-AP (Synaptotagmin-3 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28667-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 28667-1-AP (same clone as 28667-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28667-1-AP (Synaptotagmin-3 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28667-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 28667-1-AP (same clone as 28667-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using Synaptotagmin-3 antibody (28667-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 28667-1-PBS in a different storage buffer formulation.

Synaptotagmin-3 Polyclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 28667-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

---

Product Information

28667-1-PBS targets Synaptotagmin-3 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30027

  Product name: Recombinant human SYT3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 85-330 aa of BC028379

  Sequence: DKGGSAVGGGPLRKDLGPGVGLAGLVGGGGHHLAAGLGGHPLLGGPHHHAHAAHHPPFAELLEPGSLGGSDTPEPSYLDMDSYPEAAAAAVAAGVKPSQTSPELPSEGGAGSGLLLLPPSGGGLPSAQSHQQVTSLAPTTRYPALPRPLTQQTLTSQPDPSSEERPPALPLPLPGGEEKAKLIGQIKPELYQGTGPGGRRSGGGPGSGEAGTGAPCGRISFALRYLYGSDQLVVRILQAMDLPAKD

• Full Name: synaptotagmin III
• Calculated Molecular Weight: 590 aa, 63 kDa
• Observed Molecular Weight: 70-75 kDa
• GenBank Accession Number: BC028379
• Gene Symbol: Synaptotagmin-3
• Gene ID (NCBI): 84258
• RRID: AB_2918187
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BQG1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis (PMID: 8058779). Synaptotagmin-3 (SYT3) is highly expressed in brain, adipose tissue, and heart (PMID: 30545844). Synaptotagmin-3 is highly enriched in synaptic plasma membranes (PMID: 10373432). It has been reported that synaptotagmin-3 internalizes AMPA receptors to depress synaptic strength and promote forgetting (PMID: 30545844).