Synaptotagmin-5 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84452-1-RR (same clone as 84452-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84452-1-RR (Synaptotagmin-5 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84452-1-PBS in a different storage buffer formulation.

• 

  WB analysis of BxPC-3 using 84452-1-RR (same clone as 84452-1-PBS)

  BxPC-3 cells were subjected to SDS PAGE followed by western blot with 84452-1-RR (Synaptotagmin-5 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84452-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 84452-1-RR (same clone as 84452-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84452-1-RR (Synaptotagmin-5 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84452-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 84452-1-RR (same clone as 84452-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 84452-1-RR (Synaptotagmin-5 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84452-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 84452-1-RR (same clone as 84452-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 84452-1-RR (Synaptotagmin-5 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84452-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 84452-1-RR (same clone as 84452-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 84452-1-RR (Synaptotagmin-5 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84452-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 84452-1-RR (same clone as 84452-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 84452-1-RR (Synaptotagmin-5 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84452-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 84452-1-RR (same clone as 84452-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using Synaptotagmin-5 antibody (84452-1-RR, Clone: 241452E3 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 84452-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84452-1-RR

  Biolayer interferometry (BLl) kinetic assays of 84452-1-RR against Human Synaptotagmin-5 were performed. The affinity constant is 0.131 nM.

Synaptotagmin-5 Uni-rAb^® Recombinant Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 84452-1-PBS

Clone No.241452E3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

SytV, SYT5, Synaptotagmin V, 241452E3

---

Product Information

84452-1-PBS targets Synaptotagmin-5 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag12677

  Product name: Recombinant human SYT5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 51-386 aa of BC046157

  Sequence: YRKSCRRRTGKKSQAQAQVHLQEVKGLGQSYIDKVQPEVEELEPAPSGPGQQVADKHELGQLQYSLDYDFQSGQLLVGILQAMGLAALDLGGSSDPYVRVYLLPDKRRRYETKVHRQTLNPHFGETFAFKVPYVELGGRVLVMAVYDFDRFSRNDAIGEVRVPMSSVDLGRPVQAWRELQAAPREEQEKLGDICFSLRYVPTAGKLTVIVLEAKNLKKMDVGGLSDPYVKVHLLQGGKKVRKKKTTIKKNTLNPYYNEAFSFEVPCDQVQKVQVELTVLDYDKLGKNEAIGRVAVGAAAGGAGLRHWADMLANPRRPIAQWHSLRPPDRVRLLPAP

• Full Name: synaptotagmin V
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 42 kDa
• GenBank Accession Number: BC046157
• Gene Symbol: Synaptotagmin-5
• Gene ID (NCBI): 6861
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O00445
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis (PMID: 8058779). Synaptotagmin-5 (SYT5) belongs to the synaptotagmin family. Synaptotagmin-5 can function as an exocytosis regulator (PMID: 27793683) and is a protein potentially associated with the pathology of schizophrenia (PMID: 32860155).