Synaptotagmin-9 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of mouse eye using 84123-3-RR (same clone as 84123-3-PBS)

  mouse eye tissue was subjected to SDS PAGE followed by western blot with 84123-3-RR (Synaptotagmin-9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84123-3-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse retina using 84123-3-RR (same clone as 84123-3-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse retina tissue using Synaptotagmin-9 antibody (84123-3-RR, Clone: 241407A11 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 84123-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84123-3-RR

  Biolayer interferometry (BLl) kinetic assays of 84123-3-RR against Human Synaptotagmin-9 were performed. The affinity constant is 22.5 nM.

Synaptotagmin-9 Uni-rAb^® Recombinant Antibody for WB, IF-P, Indirect ELISA

Cat No. 84123-3-PBS

Clone No.241407A11

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF-P, Indirect ELISA

Synonyms

SytIX, SYT9, Synaptotagmin IX, 241407A11

---

Product Information

84123-3-PBS targets Synaptotagmin-9 in WB, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3520

  Product name: Recombinant human SYT9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 45-319 aa of BC029605

  Sequence: LCWVPWRERGLPSGSKDNNQEPLNYMDTETNEQENSEDFLDPPTPCPDSSMKISHTSPDIPLSTQTGIQENCAHGVRVQRQVTEPTSSARHNSIRRQLNLSNPDFNIQQLQKQEQLTGIGRIKPELYKQRSLDNDDGRRSNSKACGKLNFILKYDCDLEQLIVKIHKAVNLPAKDFSGTSDPYVKIYLLPDRKTKHQTKVHRKTLNPVFDEVFLFPVPYNDLEARKLHFSVYDFDRFSRHDLIGQVVVDHFLDLADFPRECILWKDIEYVTNILR

• Full Name: synaptotagmin IX
• Calculated Molecular Weight: 491 aa, 52 kDa
• Observed Molecular Weight: 52-56 kDa
• GenBank Accession Number: BC029605
• Gene Symbol: Synaptotagmin-9
• Gene ID (NCBI): 143425
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q86SS6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The synaptotagmins are integral membrane proteins of synaptic vesicles thought to serve as Ca(2+) sensors in the process of vesicular trafficking and exocytosis (PMID: 8058779). Synaptotagmin-9 (SYT9) is a tandem C2 domain Ca 2+ sensor for exocytosis in neuroendocrine cells (PMID: 36732068).