Syndetin/CCDC132 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Syndetin/CCDC132 Polyclonal antibody, PBS Only (27749-1-PBS)

• 

  WB analysis using 27749-1-AP (same clone as 27749-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27749-1-AP (Syndetin antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27749-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 27749-1-AP (same clone as 27749-1-PBS)

  IP result of anti-Syndetin/CCDC132 (IP:27749-1-AP, 4ug; Detection:27749-1-AP 1:300) with mouse brain tissue lysate 4000 ug. This data was developed using the same antibody clone with 27749-1-PBS in a different storage buffer formulation.

Syndetin/CCDC132 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 27749-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

---

Product Information

27749-1-PBS targets Syndetin/CCDC132 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26944

  Product name: Recombinant human CCDC132 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 337-593 aa of BC152424

  Sequence: EWHEKHDNEDTASASEGSNMIGTEETNFDRGYIKKKLEHGLTRIWQDVQLKVKTYLLGTDLSIFKYDDFIFVLDIISRLMQVGEEFCGSKSEVLQESIRKQSVNYFKNYHRTRLDELRMFLENETWELCPVKSNFSILQLHEFKFMEQSRSPSVSPSKQPVSTSSKTVTLFEQYCSGGNPFEIQANHKDEETEDVLASNGYESDEQEKSAYQEYDSDSDVPEELKRDYVDEQTGDGPVKSVSRETLKSRKKSDYSLN

• Full Name: coiled-coil domain containing 132
• Calculated Molecular Weight: 964 aa, 111 kDa
• Observed Molecular Weight: 110-120 kDa
• GenBank Accession Number: BC152424
• Gene Symbol: Syndetin/CCDC132
• Gene ID (NCBI): 55610
• RRID: AB_2880961
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96JG6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.