Home
Products
Primary Antibodies
Syndetin/CCDC132 Polyclonal antibody, PBS Only (27749-1-PBS)

Syndetin/CCDC132 Polyclonal antibody, PBS Only

Name: Syndetin/CCDC132 Polyclonal antibody, PBS Only,
Brand: Proteintech

Syndetin/CCDC132 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 27749-1-PBS

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

CCDC132, Syndetin, Coiled-coil domain-containing protein 132, VPS50

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIPIHC

WB analysis using 27749-1-AP (same clone as 27749-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 27749-1-AP (Syndetin antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27749-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IP experiment of mouse brain using 27749-1-AP (same clone as 27749-1-PBS)
IP result of anti-Syndetin/CCDC132 (IP:27749-1-AP, 4ug; Detection:27749-1-AP 1:300) with mouse brain tissue lysate 4000 ug. This data was developed using the same antibody clone with 27749-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human rectal cancer using 27749-1-AP (same clone as 27749-1-PBS)
Immunohistochemical analysis of paraffin-embedded human rectal cancer tissue slide using 27749-1-AP (Syndetin/CCDC132 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27749-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse brain using 27749-1-AP (same clone as 27749-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27749-1-AP (Syndetin/CCDC132 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27749-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse skeletal muscle using 27749-1-AP (same clone as 27749-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 27749-1-AP (Syndetin/CCDC132 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27749-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human rectal cancer using 27749-1-AP (same clone as 27749-1-PBS)
Immunohistochemical analysis of paraffin-embedded human rectal cancer tissue slide using 27749-1-AP (Syndetin/CCDC132 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27749-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse brain using 27749-1-AP (same clone as 27749-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27749-1-AP (Syndetin/CCDC132 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27749-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human placenta using 27749-1-AP (same clone as 27749-1-PBS)
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 27749-1-AP (Syndetin/CCDC132 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27749-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Syndetin/CCDC132 in ?

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

27749-1-PBS targets Syndetin/CCDC132 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag26944 Product name: Recombinant human CCDC132 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 337-593 aa of BC152424 Sequence: EWHEKHDNEDTASASEGSNMIGTEETNFDRGYIKKKLEHGLTRIWQDVQLKVKTYLLGTDLSIFKYDDFIFVLDIISRLMQVGEEFCGSKSEVLQESIRKQSVNYFKNYHRTRLDELRMFLENETWELCPVKSNFSILQLHEFKFMEQSRSPSVSPSKQPVSTSSKTVTLFEQYCSGGNPFEIQANHKDEETEDVLASNGYESDEQEKSAYQEYDSDSDVPEELKRDYVDEQTGDGPVKSVSRETLKSRKKSDYSLN Predict reactive species
Full Name	coiled-coil domain containing 132
Calculated Molecular Weight	964 aa, 111 kDa
Observed Molecular Weight	110-120 kDa
GenBank Accession Number	BC152424
Gene Symbol	Syndetin/CCDC132
Gene ID (NCBI)	55610
RRID	AB_2880961
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q96JG6
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Syndetin, also known as CCDC132 or VPS50, is a critical component of the endosome-associated recycling protein (EARP) complex, which also includes ANG2/VPS51, VPS52, and VPS53 in a 1:1:1:1 ratio. The deduced 964-amino acid protein contains alpha-helical N- and C-terminal regions connected by a less structured middle region. CCDC132 is elevated in gastric cancer, where knockdown attenuates proliferation and tumorigenesis by facilitating DNA damage signaling, and its expression correlates with nodal metastasis and poor prognosis.