Syntaxin 10 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• Syntaxin 10 Monoclonal antibody (66821-1-Ig)

Syntaxin 10 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 66821-1-Ig Copied!

Clone No. 1B1C3

Publications (1)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

1B1C3, STX10, Syn10, Syntaxin-10

• 

  WB analysis using 66821-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66821-1-Ig (Syntaxin 10 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 66821-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using Syntaxin 10 antibody (66821-1-Ig, Clone: 1B1C3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Syntaxin 10 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, T-47D cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66821-1-Ig targets Syntaxin 10 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27861

  Product name: Recombinant human STX10 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-200 aa of BC017237

  Sequence: MSLEDPFFVVRGEVQKAVNTARGLYQRWCELLQESAAVGREELDWTTNELRNGLRSIEWDLEDLEETIGIVEANPGKPAAQKSPSDLLDASAVSATSRYIEEQQATQQLIMDEQDQQLEMVSGSIQVLKHMSGRVGEELDEQGIMLDAFAQEMDHTQSRMDGVLRKLAKVSHMTSDRRQWCAIAVLVGVLLLVLILLFSL

• Full Name: syntaxin 10
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC017237
• Gene Symbol: Syntaxin 10
• Gene ID (NCBI): 8677
• RRID: AB_2882164
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O60499
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Syntaxin 10 (STX10), also named as SYN10, belongs to the syntaxin family. Syntaxins are target membrane SNAREs(Soluble NSF attachment protein receptors) which are membrane components that determine the specificity of the docking and fusion of vesicles to target membranes.

Publications

What published studies show

The Syntaxin 10 Monoclonal antibody (1B1C3), catalog number 66821-1-Ig, has 1 citation. It appears in International Immunopharmacology (IF 5.6), published in 2026. The cited study focuses on non-small cell lung cancer, specifically identifying histone acetylation-related genes as mediators of PD-1-driven immune evasion and prognosis. The antibody was used in Western Blot (WB) on human samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Int Immunopharmacol; Integrative multi-omics and experimental validation identify histone acetylation-related genes BCL9L, STX10 and LSM7 as key mediators of PD-1-driven immune evasion and prognosis in non-small cell lung cancer.; Authors - Jianying Zhou