TAC3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TAC3 Polyclonal antibody, PBS Only (11606-1-PBS)

• 

  WB analysis of human placenta using 11606-1-AP (same clone as 11606-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 11606-1-AP (TAC3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11606-1-PBS in a different storage buffer formulation.

TAC3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 11606-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

11606-1-PBS targets TAC3 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2156

  Product name: Recombinant human TAC3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-121 aa of BC032145

  Sequence: MRIMLLFTAILAFSLAQSFGAVCKEPQEEVVPGGGRSKRDPDLYQLLQRLFKSHSSLEGLLKALSQASTDPKESTSPEKRDMHDFFVGLMGKRSVQPDSPTDVNQENVPSFGILKYPPRAE

• Full Name: tachykinin 3
• Calculated Molecular Weight: 13 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC032145
• Gene Symbol: TAC3
• Gene ID (NCBI): 6866
• RRID: AB_3669128
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UHF0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.