Tested Applications
| Positive IHC detected in | mouse lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21232-1-AP targets TAC4 in IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15702 Product name: Recombinant human TAC4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-57 aa of BC111858 Sequence: MLPCLALLLLMELSVCTVAGDGGEEQTLSTEAETWEGAGPSIQLQLQEVKTGKASQF Predict reactive species |
| Full Name | tachykinin 4 (hemokinin) |
| Calculated Molecular Weight | 113 aa, 12 kDa |
| GenBank Accession Number | BC111858 |
| Gene Symbol | TAC4 |
| Gene ID (NCBI) | 255061 |
| RRID | AB_3669363 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q86UU9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TAC4, or tachykinin 4, is a gene that encodes for a member of the tachykinin family of peptides, which are known for their rapid stimulation of contraction in intestinal muscles and other physiological functions. The tachykinin family includes three members in mammals: TAC1, TAC3, and TAC4. TAC4, in particular, is involved in a variety of physiological roles and has been implicated in several biological processes.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for TAC4 antibody 21232-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |



