TACSTD2/TROP2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86155-1-RR (same clone as 86155-1-PBS)

  HaCaT cells lysate was subjected to SDS PAGE followed by western blot with 86155-1-RR (TACSTD2/TROP2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86155-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 86155-1-RR (same clone as 86155-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 86155-1-RR (TACSTD2/TROP2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86155-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 86155-1-RR (same clone as 86155-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 86155-1-RR (TACSTD2/TROP2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86155-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 86155-1-RR (same clone as 86155-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 86155-1-RR (TACSTD2/TROP2 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86155-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 86155-1-RR (same clone as 86155-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 86155-1-RR (TACSTD2/TROP2 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86155-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HaCaT using 86155-1-RR (same clone as 86155-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HaCaT cells using TACSTD2/TROP2 antibody (86155-1-RR, Clone: 250382C9 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 86155-1-PBS in a different storage buffer formulation.

TACSTD2/TROP2 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 86155-1-PBS

Clone No.250382C9

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

TACSTD2, Cell surface glycoprotein Trop-2, EGP 1, GA733, GA733 1

---

Product Information

86155-1-PBS targets TACSTD2/TROP2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3329

  Product name: Recombinant Human TACSTD2/TROP2 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 27-274 aa of BC009409

  Sequence: HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

• Full Name: tumor-associated calcium signal transducer 2
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 45-55 kDa
• GenBank Accession Number: BC009409
• Gene Symbol: TROP2
• Gene ID (NCBI): 4070
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P09758
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Trophoblast cell surface antigen 2 (TROP2), also named as TACSTD2, is a transmembrane glycoprotein. TROP2 plays a role in transducing intracellular calcium signals. It is expressed in trophoblast cells, cornea and multi-stratified epithelia. TROP2 is overexpressed in most carcinomas and is involved in cancer proliferation, migration, invasion, and metastasis. Congenital mutations of TROP2 cause a rare autosomal recessive disease which may lead to blindness-the gelatinous drop-like corneal disease (PMID: 35688908).