Anti-Human TACSTD2/TROP2 Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• Anti-Human TACSTD2/TROP2 Rabbit Recombinant Antibody (98465-2-RR)

TACSTD2/TROP2 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98465-2-RR Copied!

Clone No. 250382A12

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

TACSTD2, Cell surface glycoprotein Trop-2, EGP 1, GA733, GA733 1

• 

  FC experiment of MCF-7 using 98465-2-RR

  1x10^6 MCF-7 cells were surface stained with 0.25 ug Anti-Human TACSTD2/TROP2 Rabbit RecAb (98465-2-RR, Clone: 250382A12) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TACSTD2/TROP2 in ?

Chat with Able

---

Tested Applications

• Positive FC detected in: MCF-7 cells

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98465-2-RR targets TACSTD2/TROP2 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3329

  Product name: Recombinant Human TACSTD2/TROP2 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 27-274 aa of BC009409

  Sequence: HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

• Full Name: tumor-associated calcium signal transducer 2
• Calculated Molecular Weight: 36 kDa
• GenBank Accession Number: BC009409
• Gene Symbol: TROP2
• Gene ID (NCBI): 4070
• RRID: AB_3746094
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P09758
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2 - 8°C. Stable for one year after shipment.

Background Information

Trophoblast cell surface antigen 2 (TROP2), also named as TACSTD2, is a transmembrane glycoprotein. TROP2 plays a role in transducing intracellular calcium signals. It is expressed in trophoblast cells, cornea and multi-stratified epithelia. TROP2 is overexpressed in most carcinomas and is involved in cancer proliferation, migration, invasion, and metastasis. Congenital mutations of TROP2 cause a rare autosomal recessive disease which may lead to blindness-the gelatinous drop-like corneal disease (PMID: 35688908).