• Featured Product
  • KD/KO Validated

TADA1L Recombinant monoclonal antibody, PBS Only (Capture)

TADA1L Uni-rAb® Recombinant Antibody for WB, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA
Cat No. 83641-4-PBS
Clone No.240637F7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, FC (Intra), Cytometric bead array, Indirect ELISA

240637F7, KIAA0764, RP1 9E21.4, SPT3 associated factor 42, SPT3-associated factor 42

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83641-4-PBS targets TADA1L as part of a matched antibody pair:

MP00624-1: 83641-4-PBS capture and 83641-5-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag14118

Product name: Recombinant human TADA1L protein

Source: e coli.-derived, T-HIS

Tag: 6*His

Domain: 1-335 aa of BC015401

Sequence: MATFVSELEAAKKNLSEALGDNVKQYWANLKLWFKQKISKEEFDLEAHRLLTQDNVHSHNDFLLAILTRCQILVSTPDGAGSLPWPGGSAAKPGKPKGKKKLSSVRQKFDHRFQPQNPLSGAQQFVAKDPQDDDDLKLCSHTMMLPTRGQLEGRMIVTAYEHGLDNVTEEAVSAVVYAVENHLKDILTSVVSRRKAYRLRDGHFKYAFGSNVTPQPYLKNSVVAYNNLIESPPAFTAPCAGQNPASHPPPDDAEQQAALLLACSGDTLPASLPPVNMYDLFEALQVHREVIPTHTVYALNIERIITKLWHPNHEELQQDKVHRQRLAAKEGLLLC

Predict reactive species
Full Name transcriptional adaptor 1 (HFI1 homolog, yeast)-like
Calculated Molecular Weight 335 aa, 37 kDa
Observed Molecular Weight 37-40 kDa
GenBank Accession NumberBC015401
Gene Symbol TADA1L
Gene ID (NCBI) 117143
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96BN2
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

The function of TADA1L has not been widely studied, and is yet to be fully elucidated. It probably involved in transcriptional regulation.

Loading...
||
New chat Able
正在加载,请稍候...