TADA2B Polyclonal antibody

• 

  WB analysis using 17367-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17367-1-AP (TADA2B antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary cancer using 17367-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 17367-1-AP (TADA2B antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

TADA2B Polyclonal Antibody for WB, IHC, ELISA

Cat No. 17367-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

ADA2 beta, ADA2 like protein beta, ADA2(beta), ADA2B, ADA2-beta

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, K-562 cells, MCF-7 cells
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below

Product Information

17367-1-AP targets TADA2B in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10783

  Product name: Recombinant human TADA2B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 215-420 aa of BC013164

  Sequence: ERQRRKNIARDYNLVPAFLGKDKKEKEKALKRKITKEEKELRLKLRPLYQFMSCKEFDDLFENMHKEKMLRAKIRELQRYRRNGITKMEESAEYEAARHKREKRKENKNLAGSKRGKEDGKDSEFAAIENLPGFELLSDREKVLCSSLNLSPARYVTVKTIIIKDHLQKRQGIPSKSRLPSYLDKVLKKRILNFLTESGWISRDAS

• Full Name: transcriptional adaptor 2 (ADA2 homolog, yeast)-beta
• Calculated Molecular Weight: 420 aa, 48 kDa
• Observed Molecular Weight: 55-62 kDa
• GenBank Accession Number: BC013164
• Gene Symbol: TADA2B
• Gene ID (NCBI): 93624
• RRID: AB_2201049
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86TJ2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; MYC Controls the Epstein-Barr Virus Lytic Switch.; Authors - Rui Guo ; KO Validated
human	WB	Sci Adv; The KAT module of the SAGA complex maintains the oncogenic gene expression program in MYCN-amplified neuroblastoma; Authors - Clare F Malone