TAF10 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TAF10 Polyclonal antibody (20346-1-AP)

TAF10 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 20346-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ChIP, ELISA

Synonyms

STAF28, TAF(II)30, TAF10, TAF2A, TAF2H, TAFII 30, TAFII30

• 

  WB analysis of mouse testis using 20346-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 20346-1-AP (TAF10 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 20346-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 20346-1-AP (TAF10 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse testis using 20346-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 20346-1-AP (TAF10 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TAF10 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse testis tissue, rat testis tissue
• Positive IHC detected in: mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:500
• Immunohistochemistry (IHC): IHC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20346-1-AP targets TAF10 in WB, IHC, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14153

  Product name: Recombinant human TAF10 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 70-218 aa of BC012088

  Sequence: EPAERRGAAPVSAGGAAPPEGAISNGVYVLPSAANGDVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLNRAGFEASDPRIIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRKYTLTMEDLTPALSEYGINVKKPHYFT

• Full Name: TAF10 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 30kDa
• Calculated Molecular Weight: 218 aa, 22 kDa
• Observed Molecular Weight: 29 kDa
• GenBank Accession Number: BC012088
• Gene Symbol: TAF10
• Gene ID (NCBI): 6881
• RRID: AB_2878678
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q12962
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The TAF10 Polyclonal antibody (Cat# 20346-1-AP) has 2 citations. One appeared in Molecular Cell (IF 16), studying how Integrator maintains pluripotency during development via TFIID and RNA polymerase II association in mouse (ChIP). The other was published in Biochemical Pharmacology (IF 6.5), investigating calcium saccharate/DUSP6 suppression of renal cell carcinoma glycolytic metabolism and enhancement of sunitinib efficacy through the ERK-AKT pathway in human samples (WB). Research fields span stem cell biology and oncology/metabolism.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	ChIP	Mol Cell; Integrator promotes the association of TFIID and RNA polymerase II to maintain pluripotency during development.; Authors - Raghu Ram Edupuganti
human	WB	Biochem Pharmacol; Calcium saccharate/DUSP6 suppresses renal cell carcinoma glycolytic metabolism and boosts sunitinib efficacy via the ERK-AKT pathway; Authors - Huan Liu