Product Information
60984-1-PBS targets TAF13 as part of a matched antibody pair:
MP51418-1: 60984-1-PBS capture and 60984-2-PBS detection (validated in Cytometric bead array)
Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18502 Product name: Recombinant human TAF13 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-124 aa of BC121180 Sequence: MADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYTESVDILEDLVIEFITEMTHKAMSIGRQGRVQVEDIVFLIRKDPRKFARVKDLLTMNEELKRARKAFDEANYGS Predict reactive species |
| Full Name | TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa |
| Calculated Molecular Weight | 124 aa, 14 kDa |
| GenBank Accession Number | BC121180 |
| Gene Symbol | TAF13 |
| Gene ID (NCBI) | 6884 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A Magarose purification |
| UNIPROT ID | Q15543 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
