TAF5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• TAF5 Polyclonal antibody, PBS Only (27041-1-PBS)

• 

  WB analysis using 27041-1-AP (same clone as 27041-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27041-1-AP (TAF5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27041-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 27041-1-AP (same clone as 27041-1-PBS)

  WB result of TAF5 antibody (27041-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-TAF5 transfected HEK-293 cells. This data was developed using the same antibody clone with 27041-1-PBS in a different storage buffer formulation.

TAF5 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 27041-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

TAF(II)100, TAF2D, TAFII 100, TAFII100, TAFII-100

---

Product Information

27041-1-PBS targets TAF5 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25742

  Product name: Recombinant human TAF5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 655-800 aa of BC136348

  Sequence: DVLNGNCVRIFTGHKGPIHSLTFSPNGRFLATGATDGRVLLWDIGHGLMVGELKGHTDTVCSLRFSRDGEILASGSMDNTVRLWDAIKAFEDLETDDFTTATGHINLPENSQELLLGTYMTKSTPVVHLHFTRRNLVLAAGAYSPQ

• Full Name: TAF5 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 100kDa
• Calculated Molecular Weight: 87 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC136348
• Gene Symbol: TAF5
• Gene ID (NCBI): 6877
• RRID: AB_3669582
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15542
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.