TAF5L Polyclonal antibody

• 

  WB analysis of Jurkat using 19274-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 19274-1-AP (TAF5L antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary cancer using 19274-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 19274-1-AP (TAF5L antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TAF5L Polyclonal Antibody for WB, IHC, ELISA

Cat No. 19274-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, CoIP, ELISA

Synonyms

TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L, PCAF-associated factor 65 beta, PCAF associated factor 65 beta, PAF65-beta, PAF65B

---

Tested Applications

• Positive WB detected in: Jurkat cells
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• CoIP: See 1 publications below

Product Information

19274-1-AP targets TAF5L in WB, IHC, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5942

  Product name: Recombinant human TAF5L protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-325 aa of BC041094

  Sequence: MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQSESGCANIVSAAPCQAEPQQYEVQFGRLRNFLTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVESFYSRFHGMFLQNASQKDVIEQLQTTQTIQDILSNFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLTLHIHLDVQPAKRTDYQLYASGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVKDGPPSLTTICFYAFYNTEQLLNTAEISPDSKLLAAGFDNSCIKLWSLRSKKLKSEPHQVDVSRIHLACDILEEEV

• Full Name: TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa
• Calculated Molecular Weight: 66 kDa
• Observed Molecular Weight: 66 kDa
• GenBank Accession Number: BC041094
• Gene Symbol: TAF5L
• Gene ID (NCBI): 27097
• RRID: AB_10642700
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75529
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	CoIP	Nat Struct Mol Biol; A cohesin traffic pattern genetically linked to gene regulation; Authors - Anne-Laure Valton
human	WB	Sci Adv; The KAT module of the SAGA complex maintains the oncogenic gene expression program in MYCN-amplified neuroblastoma; Authors - Clare F Malone