TAF7L Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TAF7L Polyclonal antibody (32590-1-AP)

• 

  WB analysis using 32590-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32590-1-AP (TAF7L antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

TAF7L Polyclonal Antibody for WB, ELISA

Cat No. 32590-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

Cancer/testis antigen 40, CT40, RNA polymerase II TBP-associated factor subunit Q, TAF2Q, TATA box-binding protein-associated factor 50 kDa

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32590-1-AP targets TAF7L in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38542

  Product name: Recombinant human TAF7L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 361-462 aa of NM_024885.3

  Sequence: DCSEEYLERQLQAEFIESGQYRANEGTSSIVMEIQKQIEKKEKKLHKIQNKAQRQKDLIMKVENLTLKNHFQSVLEQLELQEKQKNEKLISLQEQLQRFLKK*

• Full Name: TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa
• Calculated Molecular Weight: 53kDa，462aa
• Observed Molecular Weight: 53 kDa
• GenBank Accession Number: NM_024885.3
• Gene Symbol: TAF7L
• Gene ID (NCBI): 54457
• RRID: AB_3742665
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q5H9L4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TAF7L encodes a transcription initiation factor that functions as a TAF7-like component of the TFIID general transcription factor complex. It is similar to a mouse gene encoding a TATA box binding protein-associated factor, and it shows testis-specific expression. The protein is associated with RNA polymerase II preinitiation complex assembly, transcription initiation at RNA polymerase II promoters, cell differentiation, and spermatogenesis.