Tested Applications
| Positive WB detected in | HeLa cells, mouse testis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
32590-1-AP targets TAF7L in WB, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag38542 Product name: Recombinant human TAF7L protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 361-462 aa of NM_024885.3 Sequence: DCSEEYLERQLQAEFIESGQYRANEGTSSIVMEIQKQIEKKEKKLHKIQNKAQRQKDLIMKVENLTLKNHFQSVLEQLELQEKQKNEKLISLQEQLQRFLKK* Predict reactive species |
| Full Name | TAF7-like RNA polymerase II, TATA box binding protein (TBP)-associated factor, 50kDa |
| Calculated Molecular Weight | 53kDa,462aa |
| Observed Molecular Weight | 53 kDa |
| GenBank Accession Number | NM_024885.3 |
| Gene Symbol | TAF7L |
| Gene ID (NCBI) | 54457 |
| RRID | AB_3742665 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q5H9L4 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for TAF7L antibody 32590-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

