TAF9 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TAF9 Polyclonal antibody (10544-1-AP)

• Featured Product
• KD/KO Validated

TAF9 Polyclonal Antibody for WB, IP, ELISA

Cat No. 10544-1-AP Copied!

Publications (9)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

RNA polymerase II TBP-associated factor subunit G, STAF31/32, TAF2G, TAFII31, TAFII-31

• 

  WB analysis of HeLa using 10544-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 10544-1-AP (TAF9 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 10544-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 10544-1-AP (TAF9 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 10544-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10544-1-AP (TAF9 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human colon using 10544-1-AP

  human colon tissue were subjected to SDS PAGE followed by western blot with 10544-1-AP (TAF9 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human skeletal muscle using 10544-1-AP

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 10544-1-AP (TAF9 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human heart using 10544-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 10544-1-AP (TAF9 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat liver using 10544-1-AP

  rat liver tissue were subjected to SDS PAGE followed by western blot with 10544-1-AP (TAF9 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 10544-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 10544-1-AP (TAF9 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 10544-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 10544-1-AP (TAF9 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse skeletal muscle using 10544-1-AP

  IP result of anti-TAF9 (IP:10544-1-AP, 4ug; Detection:10544-1-AP 1:1000) with mouse skeletal muscle tissue lysate 2200ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TAF9 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, MCF-7 cells, human colon tissue, human skeletal muscle tissue, HEK-293 cells, human heart tissue, rat liver tissue
• Positive IP detected in: mouse skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10544-1-AP targets TAF9 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0833

  Product name: Recombinant human TAF9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-172 aa of BC007426

  Sequence: MLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIKDHNS

• Full Name: TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 32kDa
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 24-28 kDa
• GenBank Accession Number: BC007426
• Gene Symbol: TAF9
• Gene ID (NCBI): 6880
• RRID: AB_2271416
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16594
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TAF9, also named as TAF2G, TAFII31, is a 264 amino acid protein, which belongs to the TAF9 family. TAF9 are involved in transcriptional activation as well as repression of distinct but overlapping sets of genes. TAF9 may have a role in gene regulation associated with apoptosis.

Publications

What published studies show

The TAF9 antibody (catalog #10544-1-AP) has 9 total citations. These appear in journals including Advanced Science, Journal of Translational Medicine, Molecular & Cellular Proteomics, Frontiers in Pharmacology, Cancers, Journal of Cellular and Molecular Medicine, Journal of Biological Chemistry, Journal of Proteome Research, and Frontiers in Oncology. Research fields span oncology (hepatoblastoma, breast cancer, colorectal and gynecologic cancers), epithelial-mesenchymal transition, non-alcoholic fatty liver disease, proteomics, energy metabolism, and cell adhesion/migration.

Automatically generated from the 9 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IP,IHC	Adv Sci (Weinh); Ovarian Matrisome Dynamics and αvβ3-Mediated Regulation in Early Follicular Development.; Authors - Tong Wu
		J Transl Med; LncRNA938/ TAF9/TTK axis promotes EMT and serves as a therapeutic target in hepatoblastoma; Authors - Chen Jin
human	WB	Mol Cell Proteomics; Multi-Level Proteomics Reveals Epigenetic Signatures in BCG-mediated Macrophage Activation; Authors - Zoe Schaefer
rat,mouse	WB,IP,IHC	Front Pharmacol; Activation of TAF9 via Danshensu-Induced Upregulation of HDAC1 Expression Alleviates Non-alcoholic Fatty Liver Disease.; Authors - Ruiwen Wang ; KD Validated
human	IHC	Cancers (Basel); Identification of Prognostic Markers of Gynecologic Cancers Utilizing Patient-Derived Xenograft Mouse Models.; Authors - Ha-Yeon Shin
human	WB	J Cell Mol Med; Energy Metabolism Profiling of Human Colorectal Tumours; Authors - Leenu Reinsalu

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

The product received a 5-star rating for Western Blot. The reviewer noted that the antibody performed well, producing a very low background on the blot, which they found convenient for their experiments. Overall, the feedback was positive, highlighting the clean signal quality and ease of use.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Aditya (Verified Customer) (10-08-2024)

good, very low on blot - convenient

• Applications: Western Blot