TAF9B Polyclonal antibody

TAF9B Polyclonal Antibody for IHC, IP, ELISA
Cat No. 10921-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IP, ELISA

DN 7, DN7, DN-7, Neuronal cell death-related protein 7, TAF9L

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IP detected inHeLa cells
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10921-1-AP targets TAF9B in IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1362

Product name: Recombinant human TAF9B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-251 aa of BC010350

Sequence: MESGKMAPPKNAPRDALVMAQILKDMGITEYEPRVINQMLEFAFRYVTTILDDAKIYSSHAKKPNVDADDVRLAIQCRADQSFTSPPPRDFLLDIARQKNQTPLPLIKPYAGPRLPPDRYCLTAPNYRLKSLIKKGPNQGRLVPRLSVGAVSSKPTTPTIATPQTVSVPNKVATPMSVTSQRFTVQIPPSQSTPVKPVPATTAVQNVLINPSMIGPKNILITTNMVSSQNTANEANPLKRKHEDDDDNDIM

Predict reactive species
Full Name TAF9B RNA polymerase II, TATA box binding protein (TBP)-associated factor, 31kDa
Calculated Molecular Weight 28 kDa
Observed Molecular Weight 26 kDa
GenBank Accession NumberBC010350
Gene Symbol TAF9B
Gene ID (NCBI) 51616
RRIDAB_2199344
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9HBM6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Transcription initiation factor TFIID subunit 9B (TAF9B), also names neuronal cell death-related protein 7,transcription initiation factor TFIID subunit 9-like,transcription-associated factor TAFII31L. It is essential for cell viability. TAF9 and TAF9B are involved in transcriptional activation as well as repression of distinct but overlapping sets of genes. May have a role in gene regulation associated with apoptosis. TAFs are components of the transcription factor IID (TFIID) complex, the TBP-free TAFII complex (TFTC), the PCAF histone acetylase complex and the STAGA transcription coactivator-HAT complex. TFIID or TFTC are essential for the regulation of RNA polymerase II-mediated transcription.It's molecular mass is 31kd.

Loading...
||
New chat Able
正在加载,请稍候...