TAFA1/FAM19A1 Polyclonal antibody

• 

  WB analysis using 32791-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32791-1-AP (TAFA1/FAM19A1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

TAFA1/FAM19A1 Polyclonal Antibody for WB, ELISA

Cat No. 32791-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Chemokine-like protein TAFA-1, FAM19A1, TAFA1

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue, rat cerebellum

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32791-1-AP targets TAFA1/FAM19A1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37253

  Product name: Recombinant human FAM19A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 68-133 aa of BC025746

  Sequence: SCLPGKVAGTTRNRPSCVDASIVIGKWWCEMEPCLEGEECKTLPDNSGWMCATGNKIKTTRIHPRT

• Full Name: family with sequence similarity 19 (chemokine (C-C motif)-like), member A1
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC025746
• Gene Symbol: FAM19A1
• Gene ID (NCBI): 407738
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q7Z5A9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TAFA1, also named as FAM19A1, is a secreted protein that belongs to a small family of cytokines characterized by a conserved FAFA (FAM19 and TAFA) structural domain. It is predominantly expressed in specific regions of the central nervous system, particularly the brain. Functionally, TAFA1 acts as a chemokine-like factor, playing a crucial role in regulating immune cell migration and activation within the brain, thereby contributing to neuroimmune communication. Furthermore, growing evidence highlights its significance in various pathological processes, including modulating neuroinflammation, influencing the progression of neurodegenerative diseases, and even exhibiting context-dependent roles in certain cancers. TAFA1/FAM19A1 can be detected as about 15 kDa.