Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue, rat cerebellum |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
32791-1-AP targets TAFA1/FAM19A1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag37253 Product name: Recombinant human FAM19A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 68-133 aa of BC025746 Sequence: SCLPGKVAGTTRNRPSCVDASIVIGKWWCEMEPCLEGEECKTLPDNSGWMCATGNKIKTTRIHPRT Predict reactive species |
| Full Name | family with sequence similarity 19 (chemokine (C-C motif)-like), member A1 |
| Observed Molecular Weight | 15 kDa |
| GenBank Accession Number | BC025746 |
| Gene Symbol | FAM19A1 |
| Gene ID (NCBI) | 407738 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q7Z5A9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TAFA1, also named as FAM19A1, is a secreted protein that belongs to a small family of cytokines characterized by a conserved FAFA (FAM19 and TAFA) structural domain. It is predominantly expressed in specific regions of the central nervous system, particularly the brain. Functionally, TAFA1 acts as a chemokine-like factor, playing a crucial role in regulating immune cell migration and activation within the brain, thereby contributing to neuroimmune communication. Furthermore, growing evidence highlights its significance in various pathological processes, including modulating neuroinflammation, influencing the progression of neurodegenerative diseases, and even exhibiting context-dependent roles in certain cancers. TAFA1/FAM19A1 can be detected as about 15 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for TAFA1/FAM19A1 antibody 32791-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

