Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

TAOK2 Polyclonal antibody

TAOK2 Polyclonal Antibody for WB, IP, IHC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, IP, ELISA

hKFC C, KIAA0881, Kinase from chicken homolog C, MAP3K17, PSK, PSK 1, PSK1, TAO kinase 2, TAO1, TAO2, TAOK2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for TAOK2 in ?

Tested Applications

Positive WB detected inmouse brain tissue, HEK-293 cells, L02 cells
Positive IP detected inHEK-293 cells
Positive IHC detected inhuman liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21188-1-AP targets TAOK2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, monkey
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag15521

Product name: Recombinant human TAOK2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 742-969 aa of BC142663

Sequence: SLKVRAGQRPPGLPLPIPGALGPPNTGTPIEQQPCSPGQEAVLDQRMLGEEEEAVGERRILGKEGATLEPKQQRILGEESGAPSPSPQKHGSLVDEEVWGLPEEIEELRVPSLVPQERSIVGQEEAGTWSLWGKEDESLLDEEFELGWVQGPALTPVPEEEEEEEEGAPIGTPRDPGDGCPSPDIPPEPPPTHLRPCPASQLPGLLSHGLLAGLSFAVGSSSGLLPLL

Predict reactive species
Full Name TAO kinase 2
Calculated Molecular Weight 1235 aa, 138 kDa
Observed Molecular Weight 138-150 kDa
GenBank Accession NumberBC142663
Gene Symbol TAOK2
Gene ID (NCBI) 9344
RRIDAB_10755293
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UL54
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TAOK2(Serine/threonine-protein kinase TAO2) is also named as KIAA0881, MAP3K17, PSK, PSK1 and belongs to the protein kinase superfamily. TAOK2 is known to modulate gene transcription via its activation of several MAP kinase pathways, including c-Jun amino-terminal kinase (JNK), and has been implicated in the modulation of actin and microtubule dynamics. The time course of TAOK2 expression is consistent with a role for it in neuronal differentiation.(PMID:22735514). The immunogen of this antibody is 742-969 aa of human TAOK2 protein isoform Alpha.This antibody mainly detects the isoform 1/3/4. It can't detect the isoform 2.

Protocols

Product Specific Protocols
IHC protocol for TAOK2 antibody 21188-1-APDownload protocol
IP protocol for TAOK2 antibody 21188-1-APDownload protocol
WB protocol for TAOK2 antibody 21188-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Anti-TAOK1 (21188-1-AP) has 7 citations published in Nature Immunology, American Journal of Human Genetics, Molecular Cancer Therapeutics, Acta Neuropathologica Communications, Journal of Biological Chemistry, Journal of Cell Science, and Molecular Carcinogenesis. Research fields span CAR-T cell immunotherapy, tau-related neurodegeneration, centrosome/mitosis biology, and oncology (breast and esophageal cancer). Applications include WB and IF in human and monkey samples.

SpeciesApplicationTitle
humanWB

Nat Immunol

A multi-kinase inhibitor screen identifies inhibitors preserving stem-cell-like chimeric antigen receptor T cells

Authors - Feifei Song
humanWB,IF

Am J Hum Genet

Variants in EXOSC9 Disrupt the RNA Exosome and Result in Cerebellar Atrophy with Spinal Motor Neuronopathy.

Authors - David T Burns
humanWB,IF

Mol Cancer Ther

Targeting TAO kinases using a new inhibitor compound delays mitosis and induces mitotic cell death in centrosome amplified breast cancer cells.

Authors - Chuay-Yeng Koo
humanWB,IF

Acta Neuropathol Commun

A new TAO kinase inhibitor reduces tau phosphorylation at sites associated with neurodegeneration in human tauopathies.

Authors - Caterina Giacomini
MonkeyWB

J Biol Chem

Prostate-derived sterile 20-like kinases (PSKs/TAOKs) phosphorylate tau protein and are activated in tangle-bearing neurons in Alzheimer disease.

Authors - Tavares Ignatius A IA
monkeyWB

J Cell Sci

Rnd3 interacts with TAO kinases and contributes to mitotic cell rounding and spindle positioning.

Authors - Ritu Garg
Loading...
||
New chat

Able™

正在加载,请稍候...