TAOK2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86221-1-RR (same clone as 86221-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86221-1-RR (TAOK2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86221-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86221-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86221-1-RR against Human TAOK2 were performed. The affinity constant is 0.514 nM.

TAOK2 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86221-1-PBS

Clone No.250450B1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

EC:2.7.11.1, hKFC-C, KIAA0881, MAP3K17, Prostate-derived STE20-like kinase 1

---

Product Information

86221-1-PBS targets TAOK2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag15521

  Product name: Recombinant human TAOK2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 742-969 aa of BC142663

  Sequence: SLKVRAGQRPPGLPLPIPGALGPPNTGTPIEQQPCSPGQEAVLDQRMLGEEEEAVGERRILGKEGATLEPKQQRILGEESGAPSPSPQKHGSLVDEEVWGLPEEIEELRVPSLVPQERSIVGQEEAGTWSLWGKEDESLLDEEFELGWVQGPALTPVPEEEEEEEEGAPIGTPRDPGDGCPSPDIPPEPPPTHLRPCPASQLPGLLSHGLLAGLSFAVGSSSGLLPLL

• Full Name: TAO kinase 2
• Calculated Molecular Weight: 1235 aa, 138 kDa
• Observed Molecular Weight: 138-150 kDa
• GenBank Accession Number: BC142663
• Gene Symbol: TAOK2
• Gene ID (NCBI): 9344
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UL54
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TAOK2(Serine/threonine-protein kinase TAO2) is also named as KIAA0881, MAP3K17, PSK, PSK1 and belongs to the protein kinase superfamily. TAOK2 is known to modulate gene transcription via its activation of several MAP kinase pathways, including c-Jun amino-terminal kinase (JNK), and has been implicated in the modulation of actin and microtubule dynamics. The time course of TAOK2 expression is consistent with a role for it in neuronal differentiation.(PMID:22735514). The immunogen of this antibody is 742-969 aa of human TAOK2 protein isoform Alpha.This antibody mainly detects the isoform 1/3/4. It can't detect the isoform 2.