TAOK3 Polyclonal antibody

• 

  WB analysis of Raji using 28403-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 28403-1-AP (TAOK3 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

TAOK3 Polyclonal Antibody for WB, ELISA

Cat No. 28403-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, ELISA

Synonyms

DKFZp666H245, DPK, FLJ31808, hKFC A, JIK, JNK/SAPK inhibitory kinase, Jun kinase inhibitory kinase, KDS, Kinase from chicken homolog A, MAP3K18, TAO kinase 3, TAOK3

---

Tested Applications

• Positive WB detected in: Raji cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28403-1-AP targets TAOK3 in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29158

  Product name: Recombinant human TAOK3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 366-430 aa of BC002756

  Sequence: SMQEVMDESSSELVMMHDDESTINSSSSVVHKKDHVFIRDEAGHGDPRPEPRPTQSVQSQALHYR

• Full Name: TAO kinase 3
• Calculated Molecular Weight: 105 kDa
• Observed Molecular Weight: 100-105 kDa
• GenBank Accession Number: BC002756
• Gene Symbol: TAOK3
• Gene ID (NCBI): 51347
• RRID: AB_2918158
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H2K8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TAOK3 (Serine/threonine-protein kinase TAO3) is also named as DPK, JIK, KDS, MAP3K18. It belongs to the STE Ser/Thr protein kinase family. TAOK3 acts as an activator of the p38/MAPK14 stress-activated MAPK cascade. In response to DNA damage, it is involved in the G2/M transition DNA damage checkpoint by activating the p38/MAPK14 stress-activated MAPK cascade, probably by mediating phosphorylation of upstream MAP2K3 and MAP2K6 kinases. The protein can also be autophosphorylated (PMID:20949042).