TAP2 Polyclonal antibody

• 

  WB analysis using 10161-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10161-1-AP (TAP2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 10161-1-AP

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 10161-1-AP (TAP2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary cancer using 10161-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 10161-1-AP (TAP2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TAP2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10161-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

PSF-2, PSF2, EC:7.4.2.14, ATP-binding cassette sub-family B member 3, APT2

---

Tested Applications

• Positive WB detected in: MCF-7 cells, SH-SY5Y cells
• Positive IHC detected in: human intrahepatic cholangiocarcinoma tissue, human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

10161-1-AP targets TAP2 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0190

  Product name: Recombinant human TAP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-223 aa of BC002751

  Sequence: MRLPDLRPWTSLLLVDAALLWLLQGPLGTLLPQGLPGLWLEGTLRLGGLWGLLKLRGLLGFVGTLLLPLCLATPLTVSLRALVAGASRAPPARVASAPWSWLLVGYGAAGLSWSLWAVLSPPGAQEKEQDQVNNKVLMWRLLKLSRPDLPLLVAAFFFLVLAVLGETLIPHYSGRVIDILGGDFDPHAFASAIFFMCLFSFGSSLSAGCRGGCFTYTMSRINL

• Full Name: transporter 2, ATP-binding cassette, sub-family B (MDR/TAP)
• Calculated Molecular Weight: 76 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC002751
• Gene Symbol: TAP2
• Gene ID (NCBI): 6891
• RRID: AB_3085365
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q03519
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TAP2, also known as APT2, ABCB3, is a member of the superfamily of ATP-binding cassette (ABC) transporters. TAP2 mediates unidirectional translocation of peptide antigens from cytosol to endoplasmic reticulum (ER) for loading onto MHC class I (MHCI) molecules (PMID: 25656091). Mutations in TAP2 may be associated with Bare lymphocyte syndrome 1 (BLS1) and schizophrenia(PMID: 7517574, 24365204).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Eur J Med Res; Identification of TAP2 as a novel immune target in human cancers: insights from integrated bioinformatics and experimental approaches; Authors - Lufei Yang