TAPT1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TAPT1 Polyclonal antibody (27657-1-AP)

TAPT1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27657-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse

Applications

WB, IHC, ELISA

Synonyms

CMVFR, TAPT1

• 

  WB analysis using 27657-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27657-1-AP (TAPT1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 27657-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 27657-1-AP (TAPT1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 27657-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 27657-1-AP (TAPT1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TAPT1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: NIH/3T3 cells, mouse testis tissue
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27657-1-AP targets TAPT1 in WB, IHC, ELISA applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26360

  Product name: Recombinant human TAPT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 257-402 aa of BC066899

  Sequence: MVQATTLNVAFNSHNKSLLTIMMSNNFVEIKGSVFKKFEKNNLFQMSNSDIKERFTNYVLLLIVCLRNMEQFSWNPDHLWVLFPDVCMVIASEIAVDIVKHAFITKFNDITADVYSEYRASLAFDLVSSRQKNAYTDYSDSVARRM

• Full Name: transmembrane anterior posterior transformation 1
• Calculated Molecular Weight: 567 aa, 64 kDa
• Observed Molecular Weight: 65~70 kDa
• GenBank Accession Number: BC066899
• Gene Symbol: TAPT1
• Gene ID (NCBI): 202018
• RRID: AB_2880940
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6NXT6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The TAPT1 Polyclonal antibody (Cat# 27657-1-AP) has 1 total citation. It was cited in Bone Research in a study on Runx1's protective role against pathological progression of osteoarthritis, using IHC in mouse samples. The associated research field is bone biology and osteoarthritis.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Bone Res; Runx1 protects against the pathological progression of osteoarthritis.; Authors - Chenchen Zhou