TAT Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TAT Polyclonal antibody (33698-1-AP)

• 

  IHC staining of mouse liver using 33698-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 33698-1-AP (TAT antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 33698-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 33698-1-AP (TAT antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat liver using 33698-1-AP

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 33698-1-AP (TAT antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A549 using 33698-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using TAT antibody (33698-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

TAT Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 33698-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF/ICC, ELISA

Synonyms

EC:2.6.1.5, L-tyrosine:2-oxoglutarate aminotransferase, tyrosine aminotransferase

---

Tested Applications

• Positive IHC detected in: mouse liver tissue, rat liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33698-1-AP targets TAT in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag39227

  Product name: Recombinant human TAT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 294-454 aa of BC130534

  Sequence: IHDRRDIFGNEIRDGLVKLSQRILGPCTIVQGALKSILCRTPGEFYHNTLSFLKSNADLCYGALAAIPGLRPVRPSGAMYLMVGIEMEHFPEFENDVEFTERLVAEQSVHCLPATCFEYPNFIRVVITVPEVMMLEACSRIQEFCEQHYHCAEGSQEECDK

• Full Name: tyrosine aminotransferase
• GenBank Accession Number: BC130534
• Gene Symbol: TAT
• Gene ID (NCBI): 6898
• RRID: AB_3743054
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P17735
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Tyrosine aminotransferase, also known as tyrosine transaminase, is the first enzyme in the catabolic pathway of tyrosine. The gene of this transaminase is regulated by glucocorticoid hormones as well as via the cAMP pathway. TAT reversibly catalyses Tyr to 4-hydroxyphenylpyruvate (4-HPP), which is the substrate for pathways producing plastoquinone31, 32, tocopherols33, phenolic acid14, 28, and benzylisoquinoline alkaloid (BIA)34 in plants, although tyrosine is synthesised from 4-HPP by TAT in bacteria (28687763).