TAX1BP1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 86602-3-RR (same clone as 86602-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86602-3-RR (TAX1BP1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86602-3-PBS in a different storage buffer formulation.

TAX1BP1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 86602-3-PBS

Clone No.251529G8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

PRO0105, T6BP, Tax1-binding protein 1, TRAF6-binding protein

---

Product Information

86602-3-PBS targets TAX1BP1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5789

  Product name: Recombinant human TAX1BP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 454-789 aa of BC050358

  Sequence: KECQRLQKQINKLSDQSANNNNVFTKKTGNQQKVNDASVNTDPATSASTVDVKPSPSAAEADFDIVTKGQVCEMTKEIADKTEKYNKCKQLLQDEKAKCNKYADELAKMELKWKEQVKIAENVKLELAEVQDNYKELKRSLENPAERKMEGQNSQSPQCFKTCSEQNGYVLTLSNAQPVLQYGNPYASQETRDGADGAFYPDEIQRPPVRVPSWGLEDNVVCSQPARNFSRPDGLEDSEDSKEDENVPTAPDPPSQHLRGHGTGFCFDSSFDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQNVLNFD

• Full Name: Tax1 (human T-cell leukemia virus type I) binding protein 1
• Calculated Molecular Weight: 91 kDa
• Observed Molecular Weight: 90 kDa
• GenBank Accession Number: BC050358
• Gene Symbol: TAX1BP1
• Gene ID (NCBI): 8887
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q86VP1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TAX1BP1 (also named as T6BP and TXBP151) inhibits TNF-induced apoptosis by mediating the TNFAIP3 anti-apoptotic activity. It is degraded by caspase-3-like family proteins upon TNF-induced apoptosis. TAX1BP1 may also play a role in the pro-inflammatory cytokine IL-1 signaling cascade. TAX1BP1 binds TRAF6 but not TRAFs 1-5.