Use Able AI chat for product recommendations

TAX1BP3 Polyclonal antibody

TAX1BP3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 11692-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Tax interaction protein 1, Tax1 binding protein 3, TAX1BP3, TIP 1, TIP1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, NIH/3T3 cells, mouse kidney tissue, rat kidney tissue
Positive IHC detected inhuman colon tissue, human kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11692-1-AP targets TAX1BP3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2306

Product name: Recombinant human TAX1BP3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-124 aa of BC023980

Sequence: MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS

Predict reactive species
Full Name Tax1 (human T-cell leukemia virus type I) binding protein 3
Calculated Molecular Weight 124 aa, 14 kDa
Observed Molecular Weight 15-17 kDa
GenBank Accession NumberBC023980
Gene Symbol TAX1BP3
Gene ID (NCBI) 30851
RRIDAB_11182823
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO14907
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Tax-interacting protein 1 (TIP-1, also known as Tax1bp3 or glutaminase-interacting protein, GIP) is unique in its simple structure, a single PDZ domain is the only functional and structural unit identified so far in this small PDZ protein (124 amino acids in human and mouse). High level of TIP-1 expression was detected in human invasive breast cancer cells and that is important for tumor cell adhesion, migration and pulmonary metastasis. However, the precise biological effects of TIP-1 and its functional mechanisms have largely remained elusive. Mutation of TAX1BP3 can cause Dilated Cardiomyopathy with Septo-Optic Dysplasia (PMID: 25645515).

Protocols

Product Specific Protocols
IHC protocol for TAX1BP3 antibody 11692-1-APDownload protocol
WB protocol for TAX1BP3 antibody 11692-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
human,mouseWB,IHC

Gene

Birc3 and Tip1 are upregulated in renal ischemia reperfusion injury

Authors - Sixu Wang

Reviews

    4.2 out of 5
Add a review

4 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


CHAO (Verified Customer) (03-31-2022)

Good clear bands.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Mouse Heart

LUNFENG (Verified Customer) (01-27-2020)

GOOD

  • Applications: Immunofluorescence,

Jie (Verified Customer) (01-23-2020)

works well with a specific band that matches the product size

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:800
  • Cell Tissue Type: Human kidney biopsy

Canzhao (Verified Customer) (01-17-2020)

It is one of the best antibody I used. It is very specific. I would like to give it 6 stars if it is possible.

  • Applications: Western Blot, Immunofluorescence,
  • Primary Antibody Dilution: 1:1000 for WB, 1:100 for IF
  • Cell Tissue Type: Mouse heart and cultured cardiomyocytes.
Loading...
||
New chat

Able

正在加载,请稍候...