TBC1D10C Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TBC1D10C Polyclonal antibody (34255-1-AP)

• 

  WB analysis using 34255-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 34255-1-AP (TBC1D10C antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

TBC1D10C Polyclonal Antibody for WB, ELISA

Cat No. 34255-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Carabin, TBC1 domain family member 10C

---

Tested Applications

• Positive WB detected in: HL-60 cells, mouse spleen tissue, rat spleen tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

34255-1-AP targets TBC1D10C in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag40608

  Product name: Recombinant human TBC1D10C protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 26-138 aa of BC062999

  Sequence: SELSGPGPYRQADRYGFIGGSSAEPGPGHPPADLIRQREMKWVEMTSHWEKTMSRRYKKVKMQCRKGIPSALRARCWPLLCGAHVCQKNSPGTYQELAEAPGDPQWMETIGRD

• Full Name: TBC1 domain family, member 10C
• Calculated Molecular Weight: 446 aa, 50 kDa
• Observed Molecular Weight: 47 kDa
• GenBank Accession Number: BC062999
• Gene Symbol: TBC1D10C
• Gene ID (NCBI): 374403
• RRID: AB_3743181
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8IV04
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TBC1D10C (also known as Carabin or EPI64C) is a negative regulator of dual signaling pathways. It can inhibit the activity of small GTPase Ras through its N-terminal TBC domain, and also suppress the activity of calcineurin through its C-terminal binding site, thereby simultaneously negatively regulating the two key signaling pathways, Ras-MAPK and Ca²⁺-Calcineurin-NFAT.