TBC1D21 Polyclonal antibody

• 

  WB analysis using 17463-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17463-1-AP (TBC1D21 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat testis using 17463-1-AP

  rat testis tissue were subjected to SDS PAGE followed by western blot with 17463-1-AP (TBC1D21 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse testis using 17463-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 17463-1-AP (TBC1D21 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

TBC1D21 Polyclonal Antibody for WB, ELISA

Cat No. 17463-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Male germ cell Rab GTPase-activating protein, MGCRABGAP, TBC1 domain family member 21, TBC1 domain family, member 21

---

Tested Applications

• Positive WB detected in: mouse testis tissue, rat testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

17463-1-AP targets TBC1D21 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11301

  Product name: Recombinant human TBC1D21 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-336 aa of BC033516

  Sequence: MTTLSPENSLSARQSASFILVKRKPPIDKTEWDSFFDESGHLAKSRDFICVNILERGLHPFVRTEAWKFLTGYFSWQSSQDERLTVDSMRRKNYKALCQMYEKIQPLLENLHRNFTETRNNIARDIQKIYDKDPLGNVLIDKKRLEKILLLSYVCNTQAEYQQGFHEMMMLFQLMVEHDHETFWLFQFFLQKTEHSCVINIGVAKNLDMLSTLITFLDPVFAEHLKGKGAGAVQSLFPWFCFCFQRAFKSFDDVWRLWEVLLTGKPCRNFQVLVAYSMLQMVREQVLQESMGGDDILLACNNLIDLDADELISAACVVYAELIQKDVPQTLKDFFL

• Full Name: TBC1 domain family, member 21
• Calculated Molecular Weight: 336 aa, 39 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC033516
• Gene Symbol: TBC1D21
• Gene ID (NCBI): 161514
• RRID: AB_3085524
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IYX1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TBC1D21 genes (also known as male germ cell RAB GTPase-activating protein MGCRABGAP) are related to sterility, as determined through cDNA microarray testing of human testicular tissues exhibiting spermatogenic defects. TBC1D21 is a protein specifically expressed in the testes that exhibits specific localizations of elongating and elongated spermatids during mammalian spermiogenesis.