Tested Applications
| Positive WB detected in | HEK-293T cells, HEK-293 cells, HeLa cells, HepG2 cells |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human stomach cancer tissue, human spleen tissue, human kidney tissue, human ovary tissue, human testis tissue, human liver tissue, human placenta tissue, rat liver tissue, mouse ovary tissue, rat ovary tissue, rat stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | U2OS cells, HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:600-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:100-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
17002-1-AP targets TBC1D23 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag10697 Product name: Recombinant human TBC1D23 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-320 aa of BC010221 Sequence: MLQNPSEFAQSVKSLLEAQKQSIESGSIAGGEHLCFMGSGREEEDMYMNMVLAHFLQKNKEYVSIASGGFMALQQHLADINVDGPENGYGHWIASTSGSRSSINSVDGESPNGSSDRGMKSLVNKMTVALKTKSVNVREKVISFIENTSTPVDRHVSSSDRVGKPYRGVKPVFSIGDEEEYDTDEIDSSSMSDDDRKEVVNIQTWINKPDVKHHFPCKEVKESGHMFPSHLLVTATHMYCLREIVSRKGLAYIQSRQALNSVVKITSKKKHPELITFKYGNSSASGIEILAIERYLIPNAGDATKAIKQQIMKVLDALES Predict reactive species |
| Full Name | TBC1 domain family, member 23 |
| Calculated Molecular Weight | 699 aa, 78 kDa |
| Observed Molecular Weight | 70-78 kDa |
| GenBank Accession Number | BC010221 |
| Gene Symbol | TBC1D23 |
| Gene ID (NCBI) | 55773 |
| RRID | AB_2240206 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NUY8 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TBC1D23, also named as NS4ATP1, is a gene down-regulated by Pneumocystis infection. Pneumocystis pneumonia is a common opportunistic disease in AIDS patients. (PMID: 20377877) Recently it has been found that TBC1D23 gene is the most frequently mutated in MSI-H cell lines and protein expressions of TBC1D23 in tumors with mutation were down regulated.(PMID: 20824714) This antibody is specific to TBC1D23.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TBC1D23 antibody 17002-1-AP | Download protocol |
| IHC protocol for TBC1D23 antibody 17002-1-AP | Download protocol |
| IP protocol for TBC1D23 antibody 17002-1-AP | Download protocol |
| WB protocol for TBC1D23 antibody 17002-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The TBC1D23 Polyclonal antibody (Cat# 17002-1-AP) has 12 citations published in journals including Cell, Nature Communications, Cell Discovery, Molecular Cell, American Journal of Human Genetics, International Journal of Cancer, Journal of Cellular and Molecular Medicine, and bioRxiv. Research fields span Golgi trafficking, LKB1/TBK1 signaling, alternative splicing in hematopoiesis, endosome–Golgi interface, chromosome stability, pontocerebellar hypoplasia, cancer (MSI-H, NSCLC), DNA repair, and AAV transduction.
| Species | Application | Title |
|---|---|---|
Nat Commun The functional landscape of alternative splicing in hematopoietic lineage commitment.
| ||
Nat Commun A CRISPR/Cas9 screen reveals proteins at the endosome-Golgi interface that modulate cellular anti-sense oligonucleotide activity.
| ||
Cell Discov Trans-Golgi network tethering factors regulate TBK1 trafficking and promote the STING-IFN-I pathway
| ||
Reviews
What customers say
Users report the antibody performs adequately for Western Blot, detecting the expected TBC1D23 band around 70–78 kDa, though one reviewer noted the signal was somewhat faint at 1:250 dilution. For immunofluorescence, most cells showed the expected Golgi localization, but not all, and high background was observed at 1:100 dilution. Overall, the antibody works for its intended applications with some variability in signal intensity and background levels depending on cell type and dilution used.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Ioana (Verified Customer) (08-28-2025) | This antibody works well in Western Blotting. Band size is what I had expected, but it is a little faint.
|
Christine (Verified Customer) (01-27-2023) | Main band detected below the 85 kDa marker (expected size of TBC1D23 is 78, observed is 70-78).
|
Jerome (Verified Customer) (05-22-2019) | Most cells show the expected Golgi localisation; but not all. High background
 |
