Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

TBC1D23 Polyclonal antibody

TBC1D23 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 17002-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

HCV non-structural protein 4A-transactivated protein 1, NS4ATP1, TBC1 domain family member 23, TBC1 domain family, member 23

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293T cells, HEK-293 cells, HeLa cells, HepG2 cells
Positive IP detected inHepG2 cells
Positive IHC detected inhuman stomach cancer tissue, human kidney tissue, human liver tissue, human ovary tissue, human spleen tissue, human testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inU2OS cells, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:600-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:100-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17002-1-AP targets TBC1D23 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag10697

Product name: Recombinant human TBC1D23 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-320 aa of BC010221

Sequence: MLQNPSEFAQSVKSLLEAQKQSIESGSIAGGEHLCFMGSGREEEDMYMNMVLAHFLQKNKEYVSIASGGFMALQQHLADINVDGPENGYGHWIASTSGSRSSINSVDGESPNGSSDRGMKSLVNKMTVALKTKSVNVREKVISFIENTSTPVDRHVSSSDRVGKPYRGVKPVFSIGDEEEYDTDEIDSSSMSDDDRKEVVNIQTWINKPDVKHHFPCKEVKESGHMFPSHLLVTATHMYCLREIVSRKGLAYIQSRQALNSVVKITSKKKHPELITFKYGNSSASGIEILAIERYLIPNAGDATKAIKQQIMKVLDALES

Predict reactive species
Full Name TBC1 domain family, member 23
Calculated Molecular Weight 699 aa, 78 kDa
Observed Molecular Weight 70-78 kDa
GenBank Accession NumberBC010221
Gene Symbol TBC1D23
Gene ID (NCBI) 55773
RRIDAB_2240206
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NUY8
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TBC1D23, also named as NS4ATP1, is a gene down-regulated by Pneumocystis infection. Pneumocystis pneumonia is a common opportunistic disease in AIDS patients. (PMID: 20377877) Recently it has been found that TBC1D23 gene is the most frequently mutated in MSI-H cell lines and protein expressions of TBC1D23 in tumors with mutation were down regulated.(PMID: 20824714) This antibody is specific to TBC1D23.

Protocols

Product Specific Protocols
IF protocol for TBC1D23 antibody 17002-1-APDownload protocol
IHC protocol for TBC1D23 antibody 17002-1-APDownload protocol
IP protocol for TBC1D23 antibody 17002-1-APDownload protocol
WB protocol for TBC1D23 antibody 17002-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanWB

Cell

The WDR11 complex is a receptor for acidic-cluster-containing cargo proteins

Authors - Huaqing Deng
WB

Nat Commun

TBC1D23 mediates Golgi-specific LKB1 signaling

Authors - Yingfeng Tu
humanIF

Am J Hum Genet

Homozygous Truncating Variants in TBC1D23 Cause Pontocerebellar Hypoplasia and Alter Cortical Development.

Authors - Ekaterina L Ivanova
humanWB,IF

Am J Hum Genet

Homozygous Mutations in TBC1D23 Lead to a Non-degenerative Form of Pontocerebellar Hypoplasia.

Authors - Isaac Marin-Valencia
humanWB,IHC

Int J Cancer

Identification of frequently mutated genes with relevance to nonsense mediated mRNA decay in the high microsatellite instability cancers.

Authors - Shin Nara N
humanWB,IHC,IF

J Cell Mol Med

TBC1 domain family member 23 interacts with Ras-related protein Rab-11A to promote poor prognosis of non-small-cell lung cancer via β1-integrin.

Authors - Yao Zhang

Reviews

    3.6 out of 5
Add a review

3 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Ioana (Verified Customer) (08-28-2025)

This antibody works well in Western Blotting. Band size is what I had expected, but it is a little faint.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:250
  • Cell Tissue Type: HeLaM

Christine (Verified Customer) (01-27-2023)

Main band detected below the 85 kDa marker (expected size of TBC1D23 is 78, observed is 70-78).

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1,000
  • Cell Tissue Type: HEK293T

Jerome (Verified Customer) (05-22-2019)

Most cells show the expected Golgi localisation; but not all. High background

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: HeLa cells
TBC1D23 Antibody Immunofluorescence, validation (1:100 dilution) in HeLa cells (Cat no:17002-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...